Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G06290-AT1G06310
Species:Arabidopsis
Duplication type:TD
Function (paralog1):acyl-CoA oxidase 3
Function (paralog2):acyl-CoA oxidase 6

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-3.4937237193246
Log2 mRNA fold difference:-4.2694537378588
Log2 TE fold difference:0.7462864175911
Sequences
Protein sequence

MSDNRALRRAHVLANHILQSNPPSSNPSLSRELCLQYSPPELNESYGFDVKEMRKLLDGH
NVVDRDWIYGLMMQSNLFNRKERGGKIFVSPDYNQTMEQQREITMKRIWYLLENGVFKGW
LTETGPEAELRKLALLEVCGIYDHSVSIKVGVHFFLWGNAVKFFGTKRHHEKWLKNTEDY
VVKGCFAMTELGHGSNVRGIETVTTYDPKTEEFVINTPCESAQKYWIGGAANHATHTIVF
SQLHINGTNQGVHAFIAQIRDQDGSICPNIRIADCGHKIGLNGVDNGRIWFDNLRIPREN
LLNAVADVSSDGKYVSSIKDPDQRFGAFMAPLTSGRVTIASSAIYSAKVGLSIAIRYSLS
RRAFSVTANGPEVLLLDYPSHQRRLLPLLAKTYAMSFAANELKMIYVKRTPETNKAIHVV
SSGFKAVLTWHNMHTLQECREAVGGQGVKTENLVGQLKGEFDVQTTFEGDNNVLMQQVSK
ALFAEYVSCKKRNKPFKGLGLEHMNSPRPVLPTQLTSSTLRCSQFQTNVFCLRERDLLEQ
FTSEVAQLQGRGESREFSFLLSHQLAEDLGKAFTEKAILQTILDAEAKLPTGSVKDVLGL
VRSMYALISLEEDPSLLRYGYLSQDNVGDVRREVSKLCGELRPHALALVTSFGIPDSFLS
PIAFNWVEANAWSSV

MSENVELRRAHILANHILRSPRPSSNPSLTPEVCFQYSPPELNESYGFEVKEMRKLLDGH
NLEERDWLYGLMMQSNLFNPKQRGGQIFVSPDYNQTMEQQRQISMKRIFYLLEKGVFQGW
LTETGPEAELKKFALYEVCGIYDYSLSAKLGVHFLLWGNAVKFFGTKRHHEKWLKDTEDY
VVKGCFAMTELGHGTNVRGIETVTTYDPTTEEFVINTPCESAQKYWIGEAANHANHAIVI
SQLSMNGTNQGIHVFIAQIRDHDGNTCPNVRIADCGHKIGLNGVDNGRIWFDNLRIPREN
LLNSVADVLADGKYVSSIKDPDQRFGAFLAPLTSGRVTIASSAIYSAKLGLAVAIRYSLS
RRAFSVAANGPEVLLLDYPSHQRRLLPLLAKTYAMSFAVNDLKMIYVKRTPETNKAIHVV
SSGFKAVLTWHNMRTLQECREAVGGQGLKTENRVGHLKGEYDVQTTFEGDNNVLMQLVSK
ALFAEYVSCKKRNKPFKGLGLEHMNSPRPVLPTQLTSSTLRCSQFQKSVFCLRERDLLER
FTSEVAELQGRGESREFLFLLNHQLSEDLSKAFTEKAILQTVLDAEAKLPPGSVKDVLGL
VRSMYALISLEEDPSLLRYGHLSRDNVGDVRKEVSKLCGELRPHALALVASFGIPDAFLS
PIAFNWVEANAWSSL

www.000webhost.com

Other information
Ka divergence:0.214591KaKs divergence:-0.107433
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):2028Length 2 (bp):2028Length divergence:0
MFE 1 (kcal):-638.33MFE 2 (kcal):-616.31MFE divergence-0.018