Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G06390-AT2G30980
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):GSK3/SHAGGY-like protein kinase 1
Function (paralog2):SHAGGY-related protein kinase dZeta

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.54146423585588
Log2 mRNA fold difference:-0.6702039447188
Log2 TE fold difference:1.1733386696944
Sequences
Protein sequence

MASLPLGPQPHALAPPLQLHDGDALKRRPELDSDKEMSAAVIEGNDAVTGHIISTTIGGK
NGEPKQTISYMAERVVGTGSFGIVFQAKCLETGESVAIKKVLQDRRYKNRELQLMRPMDH
PNVISLKHCFFSTTSRDELFLNLVMEYVPETLYRVLRHYTSSNQRMPIFYVKLYTYQIFR
GLAYIHTVPGVCHRDVKPQNLLVDPLTHQVKLCDFGSAKVLVKGEPNISYICSRYYRAPE
LIFGATEYTASIDIWSAGCVLAELLLGQPLFPGENSVDQLVEIIKVLGTPTREEIRCMNP
NYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFNELREP
NARLPNGRPLPPLFNFKQELGGASMELINRLIPEHVRRQMSTGLQNS

MTSIPLGPPQPPSLAPQPPHLHGGDSLKRRPDIDNDKEMSAAVIEGNDAVTGHIISTTIG
GKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGESVAIKKVLQDRRYKNRELQLMRLM
DHPNVVSLKHCFFSTTTRDELFLNLVMEYVPETLYRVLKHYTSSNQRMPIFYVKLYTYQI
FRGLAYIHTAPGVCHRDVKPQNLLVDPLTHQCKLCDFGSAKVLVKGEANISYICSRYYRA
PELIFGATEYTSSIDIWSAGCVLAELLLGQPLFPGENSVDQLVEIIKVLGTPTREEIRCM
NPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFNELR
EPNARLPNGRPLPPLFNFKQELSGASPELINRLIPEHVRRQMNGGFPFQAGP

www.000webhost.com

Other information
Ka divergence:-0.0991746KaKs divergence:-0.0905378
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):1224Length 2 (bp):1239Length divergence:0.006
MFE 1 (kcal):-363.93MFE 2 (kcal):-370.47MFE divergence0.009