Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G06620-AT1G06640
Species:Arabidopsis
Duplication type:TD
Function (paralog1):2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein
Function (paralog2):2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.1121199044568
Log2 mRNA fold difference:2.7331315879125
Log2 TE fold difference:-1.5128515377582
Sequences
Protein sequence

MESSLPQVAALDRSTLLKAFDETKTGVKGLIDAGITEIPSIFRAPPATLTSPKPPSSSDF
SIPTIDLKGGGTDSITRRSLVEKIGDAAEKWGFFQVINHGIPMDVLEKMIDGIREFHEQD
TEVKKGFYSRDPASKMVYSSNFDLFSSPAANWRDTLGCYTAPDPPRPEDLPATCGEMMIE
YSKEVMKLGKLLFELLSEALGLNTNHLKDMDCTNSLLLLGHYYPPCPQPDLTLGLTKHSD
NSFLTILLQDHIGGLQVLHDQYWVDVPPVPGALVVNVGDLLQLITNDKFISVEHRVLANV
AGPRISVACFFSSYLMANPRVYGPIKEILSEENPPNYRDTTITEYAKFYRSKGFDGTSGL
LYLKI

MESTKIAPSFDRASELKAFDETKTGVKGLVDSGISKIPRIFHHSSVELANPKPLPSDLLH
LKTIPTIDLGGRDFQDAIKHKNAIEGIKEAAAKWGFFQVINHGVSLELLEKMKDGVRDFH
EQPPEVRKDLYSRDFGRKFIYLSNFDLYTAAAANWRDTFYCYMAPDPPEPQDLPEICRDV
MMEYSKQVMILGEFLFELLSEALGLNPNHLKDMECLKGLRMLCHYFPPCPEPDLTFGTSK
HSDGSFLTVLLPDNIEGLQVCREGYWFDVPHVPGALIINIGDLLQLITNDKFISLKHRVL
ANRATRARVSVACFFHTHVKPNPRVYGPIKELVSEENPPKYRETTIRDYATYFNGKGLGG
TSALLDFKV

Other information
Ka divergence:0.166688KaKs divergence:-0.0226378
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1098Length 2 (bp):1110Length divergence:0.005
MFE 1 (kcal):-330.43MFE 2 (kcal):-333.26MFE divergence0.004