Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G06660-AT2G30820
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.28931921378335
Log2 mRNA fold difference:-0.89601864321318
Log2 TE fold difference:0.70965910788162
Sequences
Protein sequence

MRRLLMNRNLSPLCRSVLRFIDLSVCRAMACFLDCFRARDNRSTSNLVSHSSLANSRKAQ
DSQNDLSALFLSEEKSASSPCLDKERFDLDSIHIDKGLRDEARFLKACGTIPETPIEIRK
ASQKLSPQHSGSSHFHSWISSSSSMGSRLAESSTPMKACEEVGRPSFTSEQTASSCVIDV
RDNARISSASSDGTEVESVGTAIKGELDRTARPTFTAGKNKSVRFECDLDQSNSSNSSEN
GSSRKPEMGGKICFTVSSPNPTPLKLSDEMQTPGTIYPANMESGGRGRPRIRSQFVHSVS
NIMENASLYKVYKDSHEGLDYEEQIEAETPSSETYGEKVEESSDEKLSKFEASFSPWLNQ
INENIAALNERTPGVGVITPGDRPIIGLVAAQWIENEQTEISPKMWDGNGIPNSTTKYKE
DQKVSWHATPFEVRLEKALSEEGGQSLFPQRKLEVMMEEVEGDTDISQLHHSVQPNSVVS
F

MGCLFGCFRAKDDESTTDSVSQAKHNRGHESKNRLSALFLSEASSPCHDDREGSSLNSMH
IDKDLKDDAQFLKVSCEIPATPIEVRNTSKKLETPKGGEHLRSSPSCNSEVVFHLNEKKN
EPCEEMGRSLDTSEQTPSSCLTDARNNARISSASSDDSEESIGTVFRDEVDRTGVREKTK
SVRSEIDFGQSYSSSSSKNRTASKPEMVGKTSISATSPYTTSMKLSDEIQTPGTIFPANM
ESAGRERRRIRSQFVHSASNLIVNASLCKLHEDSNANLEQAKVQAYKEKTENESPTSTIC
GEKLEESSDGKKQIGEISSSPLSINPGDRPIIGMVAAHWNEKEHSQISPKWWDGNGIPNS
TNKYKEDQKVSWHATPFEERLEKALSEEGGQGFIPPRRLGTVEESERDTAISHLRHSVIS
F

www.000webhost.com

Other information
Ka divergence:0.214799KaKs divergence:0.479667
GC content 1 (%):44GC content 2 (%):41GC content divergence:-0.035
Length 1 (bp):1446Length 2 (bp):1266Length divergence:-0.066
MFE 1 (kcal):-432.8MFE 2 (kcal):-356.79MFE divergence-0.096