Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G06670-AT2G30800
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):nuclear DEIH-boxhelicase
Function (paralog2):helicase in vascular tissue and tapetum

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.0175471461584
Log2 mRNA fold difference:-0.92098022462167
Log2 TE fold difference:2.1983259791585
Sequences
Protein sequence

MAKKKKDTKHTRLCEATGAWATKVLEDFRASGNDSYVFEQQLTNSERGIIHQMCRTMGLR
SKSNGSGEERRLSLFKGDGISKSDKRRMYEARNQKEKEGDGISKSYSKHRYETRFQKAGG
IRKTRISPKKLKCVSFPPEAKAVLHDLFTRYPPCDGDTTGTSLGIYTTGNVNSNWKDDFF
KKPHMTKHDIENNVVSLSSRLKKERHFREIFEARSKLPIASFRDAIISAVESNQVVLIAG
ETGCGKTTQVPQYLLDHMWHSKKEACKIICTQPRRISAISVSDRISWERGETIGRTVGYK
VRLQSEGGRESSVVFCTNGILLRVLIGKGVNSSVPDITHIIVDEIHERDSYSDFMLMILR
DLLPSNPHLRLILMSATLDAERFSEYFGGCPVVRVPGFTYPVRTFFLDDALSVLNSDKNS
HLLSAVKRDFKDEDKVSLDEAIDLAWTNDEFDCLVDLVSSEGSHEAYNYQNSTTGLTPLM
VFAGKGRVSDVCKLLSVGADCTLKSKEGITALELAEKENQFETAQIIREHAGNIQSNSQQ
AQDLLDKYMATIKPEEVDVGLIVKLMKKICSDSKDGAILVFLPGWEEISKTKEKLLDDRF
FAHSAKFIILCLHSRVPAEEQKKVFNRPPRGCRKIVLATNIAESAVTIDDVVYVIDSGRM
KEKSYDPYNDVSTLQSSWVSKANAKQRAGRAGRCQAGICYHLYSKLRAASLPEYRVPEVM
RMPVDELCLQVKMLDPNCNVNDFLQKLMDPPVAQSIENALIILKDIGALTPEEELTELGQ
KFGQLPVHPRISKMIYFAILVNCLDPALILACAADEKDPFTMPLSPGDRKKAAAAKHELA
SLYGDHSDHLATVAAFQCWKNAKASGQAKEFCSKYFISQVVMKRLDDLCRKLQGELNRHG
VIPSSSSNCSLNAHDPGILRAVIAVGLYPMLGRMCPLSKNRTRSVIETIAGAKVRVPSLS
NNVDMSSTKFDEALIVFDEITRGDWGVVIRSCTVLPTIPVLLFSREIAVSTTESYDAVKS
DDEEDHKVGNVGDAMDIDKEVGRPGEKIMLGPENSVKVVVDRWLPFKVTAFEIAQMYILR
ERLMASILFKVKHPKENLPPHLGASMYAIASVLSYDSLAQSSVQTVAVQPITSVVDATSP
RDDIPSTNPNELREHDPNTTPMGSKLELANKLGLGNMEESLPSNFADGNEQPDPNTSPVE
DVSAATKQKKMQSESKRCKSLNNVDLGNIEENFGNMEENPPSDLAIGNEQTLPKLASNLD
MGNMEENTPSDLANGNEKTEPNSANSMDLGNMEENTPSDLANGNKKKEPKSVSKLDLGSE
KVSIPSNLVNGNEQHDLNIAPGEDASAAKQPEKKRSRSKKRKSGNNLDLGKMEKSKPSDL
ANENEQTEPKSANNLDLGNMKENTPSDLANENEQTELRLPNNSDYGNMEESLPLNLANGD
EQPDPTTAPMEAAKQPKKKRSRSKKCKSVNNLDLGNMEENKPSDLANGNEQKDPESVNRL
DPGKEKESIPSNLVSGNEQPDSNTAPAKKPKKKKRKLANNFDSVNNMEEKMPSTNVLSQG
NKSGLIEEKPSIPSDQ

MGNKRFRSDNNAGKPTSVEATRIWATKVIEDFRASGNEVYTFEHNLSNNERGVIHQMCRK
MGIQSKSSGRGEQRRLSIFKSRHKNGNKNEANEKSNKEKLKCVSFPPGADVILQELFTHY
PPCDGDTAATSFTKYSGNKGKQGQWKDDFFRKPQISSEEILEKVASLSSRLKKDKALKEI
TKLRSKLPITSFKDAITSAVESNQVILISGETGCGKTTQVPQYLLDHMWSSKRETCKIVC
TQPRRISAMSVSERISCERGESIGENIGYKVRLQSKGGRHSSVVFCTNGILLRVLVGKGS
VSSVSDITHIIVDEIHERDCYSDFMLAIIRDLLPSNPHLRLILMSATLDAERFSGYFGGC
PVVRVPGFTYPVRTLYLEDVLSILKSGGDNHLSSTNLSISDHKLDLTDEDKLALDEAIIL
AWTNDEFDALLDLVSSRGSHEIYNYQHQSTWLTPLMVFAGKGRISDVCMLLSFGADWSLK
SKDGMTALELAEAENQLEAAQIIREHADNSQSNSQQGQQLLDKYMATINPEQVDVSLIQQ
LMRKICGDSEDGAILVFLPGWDDINKTRQRLLENPFFADSAKFDIICLHSMVPAGEQKKV
FNRPPPGCRKIVLATNIAESAVTIDDVVYVIDSGRMKEKSYDPYNNVSTLQSSWVSKANA
KQRQGRAGRCQPGICYHLYSRLRAASMPDFKVPEIKRMPVEELCLQVKILDPNCKTNDFL
QKLLDPPVDQSIANALSILQDIGALTPQEELTELGEKFGHLPVHPLISKMLFFAVLVNCL
DPALTLACAADYKEPFTMPMSPVERQKAAAAKLELASLCGGDSDHLAVVAAFECWKNAKG
RGLSAEFCSQYFVSPSAMKMLDQMRSQLESELKRHGIIPNDISSCSQNSRDPGILRAVLA
VGLYPMVGRLCPAFGNNRRTIVETASGAKVRVHSLSNNFNLSSKKYDESLLVFDEITRGD
GGMHIRNCTVARDLPLLLISTEIAVAPTGSSDSDDSNEEEEDDEEVAANTNEEVAANTNE
EGMDIHKEESRRGAKMMSSPENSVKLVVDRWLPFRTTALEVAQMYILRERLMASILFKVT
HPREHLPPHLGASMHAIAGILSYDGHAGLSCPPESMVPKHSRTEMYDTGGWEEKPNSFLN
SLFWSLSLKENKHPSHTNRNQQHNYNMAPTEAASIPRQQNYKQRNPKATNNTDSGKKKEK
MFVNPTNRINQPEAASTGKPSKHKSANSSGSSNKKENMPSDQAYGNKQHNTVPREAAAPM
AKNQSSKKTKTRSGNNSDSGKKKEQYIPKRQREDKAEQK

Other information
Ka divergence:-0.379093KaKs divergence:-0.1775
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):4731Length 2 (bp):3900Length divergence:-0.096
MFE 1 (kcal):-1375.33MFE 2 (kcal):-1175.97MFE divergence-0.078