Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G06680-AT2G30790
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):photosystem II subunit P-1
Function (paralog2):photosystem II subunit P-2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-8.503958837687
Log2 mRNA fold difference:-9.2674514104345
Log2 TE fold difference:0.76825672171745
Sequences
Protein sequence

MAYSACFLHQSALASSAARSSSSSSSQRHVSLSKPVQIICKAQQSHEDDNSAVSRRLALT
LLVGAAAVGSKVSPADAAYGEAANVFGKPKTNTDFLPYNGDGFKVQVPAKWNPSKEIEYP
GQVLRFEDNFDATSNLNVMVTPTDKKSITDYGSPEEFLSQVNYLLGKQAYFGETASEGGF
DNNAVATANILESSSQEVGGKPYYYLSVLTRTADGDEGGKHQLITATVNGGKLYICKAQA
GDKRWFKGARKFVESAATSFSVA

MITPTDKKSITDYGSPEQFLSQVNYLLGKQAYVGETASEGGFDANAVATANILETSTQEI
GGKEYYYLSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGARKFVENAAT
SFSVA

www.000webhost.com

Other information
Ka divergence:0.398451KaKs divergence:-0.238894
GC content 1 (%):50GC content 2 (%):45GC content divergence:-0.053
Length 1 (bp):792Length 2 (bp):378Length divergence:-0.354
MFE 1 (kcal):-262.56MFE 2 (kcal):-108.9MFE divergence-0.414