Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G06700-AT2G30740
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.0077796364439082
Log2 mRNA fold difference:-1.5471267070876
Log2 TE fold difference:1.5332942844032
Sequences
Protein sequence

MRKWICCTCQIEDSNEEQQLKSSQQQSDANHKNSKPAPVAKHEVKKEALPIEVPPLSLDE
VKEKTENFGSKALIGEGSYGRVYYATLNDGVAVALKKLDVAPEAETDTEFLSQVSMVSRL
KHENLIQLLGFCVDGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWITRVKIAVE
AARGLEYLHEKSQPPVIHRDIRSSNVLLFEDYKAKIADFNLSNQAPDNAARLHSTRVLGT
FGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDK
VKQCIDPKLKADYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLKPPAAAPAPE
S

MRRWICCGDKKGDSDLSNEEVHLKSPWQNSEANQKNQKPQAVVKPEAQKEALPIEVPPLS
VDEVKEKTDNFGSKSLIGEGSYGRVYYATLNDGKAVALKKLDVAPEAETNTEFLNQVSMV
SRLKHENLIQLVGYCVDENLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWLTRVKI
AVEAARGLEYLHEKVQPPVIHRDIRSSNVLLFEDYQAKVADFNLSNQAPDNAARLHSTRV
LGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLS
EDKVKQCVDPKLKGEYPPKSVAKLAAVAALCVQYESEFRPNMSIVVKALQPLLKPPAPAP
APVPES

Other information
Ka divergence:0.0984855KaKs divergence:0.154463
GC content 1 (%):44GC content 2 (%):42GC content divergence:-0.023
Length 1 (bp):1086Length 2 (bp):1101Length divergence:0.007
MFE 1 (kcal):-333.2MFE 2 (kcal):-314.66MFE divergence-0.029