Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G06760-AT2G30620
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):winged-helix DNA-binding transcription factor family protein
Function (paralog2):winged-helix DNA-binding transcription factor family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.24333610045895
Log2 mRNA fold difference:-0.28199750568591
Log2 TE fold difference:0.52174294869995
Sequences
Protein sequence

MSEVEIENAATIEGNTAADAPVTDAAVEKKPAAKGRKTKNVKEVKEKKTVAAAPKKRTVS
SHPTYEEMIKDAIVTLKERTGSSQYAIQKFIEEKRKELPPTFRKLLLLNLKRLVASGKLV
KVKASFKLPSASAKASSPKAAAEKSAPAKKKPATVAVTKAKRKVAAASKAKKTIAVKPKT
AAAKKVTAKAKAKPVPRATAAATKRKAVDAKPKAKARPAKAAKTAKVTSPAKKAVAATKK
VATVATKKKTPVKKVVKPKTVKSPAKRASSRVKK

MSIEEENVPTTVDSGAADTTVKSPEKKPAAKGGKSKKTTTAKATKKPVKAAAPTKKKTTS
SHPTYEEMIKDAIVTLKERTGSSQYAIQKFIEEKHKSLPPTFRKLLLVNLKRLVASEKLV
KVKASFKIPSARSAATPKPAAPVKKKATVVAKPKGKVAAAVAPAKAKAAAKGTKKPAAKV
VAKAKVTAKPKAKVTAAKPKSKSVAAVSKTKAVAAKPKAKERPAKASRTSTRTSPGKKVA
APAKKVAVTKKAPAKSVKVKSPAKRASTRKAKK

www.000webhost.com

Other information
Ka divergence:-0.107082KaKs divergence:0.0858653
GC content 1 (%):50GC content 2 (%):45GC content divergence:-0.053
Length 1 (bp):825Length 2 (bp):822Length divergence:-0.002
MFE 1 (kcal):-263.12MFE 2 (kcal):-247.04MFE divergence-0.032