Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G06770-AT2G30580
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):DREB2A-interacting protein 1
Function (paralog2):DREB2A-interacting protein 2

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.66094208261601
Log2 mRNA fold difference:-0.36540195713779
Log2 TE fold difference:1.2062565035321
Sequences
Protein sequence

MMIKVKKETMRACLSCSICDNILRDATTISECLHTFCRKCIYEKITEDEIETCPVCNIDL
GSTPLEKLRPDHNLQDLRAKIFALKRRKVKAPGIVSLPGKRKERSISSLVVSTPMVSAQA
GTTRRRTKAPTRKELRNGSLAERTVKKEESSGDELLESTSSPDTLNKFTQNKRQSKKSCK
ESISNKENKDGDEPWDSKMDWKPLNFLVEVANGTKPLKSSASQGSGSKSEHANVSRNQFQ
GSKTKTKNKKRKCKREDDKSNNGDPTTSETVTPKRMRTTQRKRSATTLGDSRNLPQPDES
SAKQERRNGPVWFSLVASNDQEGGTSLPQIPANFLRIRDGNTTVSFIQKYLMRKLDLESE
NEIEIKCMGEAVIPTLTLYNLVDLWLQKSSNHQRFAALVGSSAKDFTMVLVYARKLPECN
M

MEGDMVAKVKRETVVACMTCPLCDKLLRDATTISECLHTFCRKCIYEKITEDEIESCPVC
DIDLGGTPLEKLRPDHILQDLRAKLFPLKRKKERAPEVVSSISLPAKRKERSISSLVVST
PRVSAQAGTTGKRTKAATRKDVRGSGSFTKRTVKKEEEFGDDHVESASSPETLKKFTQNK
RQSSYANPNQSLSNRRNKDVDEPWDSKLHLWKPLNFLVDVANGTKDPKSELGNASHNDVQ
GSKTKTKDHKRKCKLEEEISNNGDPTTSETATLKRTRRTRRKRSSTFGDSRIPLLPGAAS
LKQERRNGHVWFSLVASSNQEGEASLPQIPANYLRIRDGNIPVSFIQKYLMRKLDLKSED
EVEITCMGEPVIPTLQLHSLVDLWLETTSKHQRVAASIGSSAKEFVMVLVYSRKLPECNN

www.000webhost.com

Other information
Ka divergence:-0.213495KaKs divergence:-0.55551
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1266Length 2 (bp):1263Length divergence:-0.001
MFE 1 (kcal):-377.6MFE 2 (kcal):-364.86MFE divergence-0.017