Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G06800-AT2G30550
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):alpha/beta-Hydrolases superfamily protein
Function (paralog2):alpha/beta-Hydrolases superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.28503029027393
Log2 mRNA fold difference:1.2663968743285
Log2 TE fold difference:-0.89272651373717
Sequences
Protein sequence

MATIPSHNLRPHTTNQRTQYSLSFRPHFSRSTLITFPARSSPARAMSRTDEEASISTRLE
QESYGLTTAEDIRRRDGEAKESKRLRDTWRKIQGEDDWAGLMDPMDPVLRSELIRYGEMA
QACYDAFDFDPFSRYCGSCRFTRRHLFDSLGIIDSGYEVARYLYATSNINLPNFFSKSRW
SKVWSKNANWMGYVAVSDDNEATRCRLGRRDIAIAWRGTVTRLEWIADLKDFLKPVSGNG
FRCPDPAVKAESGFLDLYTDKDTSCNFSKFSAREQVLTEVKRLVERYGDEEGEELSITVT
GHSLGGALAVLSAYDVAEMGVNRTRKGKVIPVTAFTYGGPRVGNIRFKERIEKLGVKVLR
VVNEHDVVAKSPGLFLNERAPQALMKLAGGLPWCYSHVGEMLPLDHQKSPFLKPTVDLST
AHNLEALLHLLDGYHGKGQRFVLSSGRDPALVNKASDFLKDHFMVPPYWRQDANKGMVRN
TDGRWIQPDRIRADDQHAPDIHQLLTQLHHPSQLL

MAAIPSHNNLLTINHKNSITGSSSLNTNFSEINFPAKFRVATRALSRTDESSLSAVISRL
ERERRERQGLLIEEAEGAGELWMTAEDIRRRDKKTEEERRLRDTWRKIQGEDDWAGLMDP
MDPILRSELIRYGEMAQACYDAFDFDPASKYCGTSRFTRLEFFDSLGMIDSGYEVARYLY
ATSNINLPNFFSKSRWSKVWSKNANWMGYVAVSDDETSRNRLGRRDIAIAWRGTVTKLEW
IADLKDYLKPVTENKIRCPDPAVKVESGFLDLYTDKDTTCKFARFSAREQILTEVKRLVE
EHGDDDDSDLSITVTGHSLGGALAILSAYDIAEMRLNRSKKGKVIPVTVLTYGGPRVGNV
RFRERMEELGVKVMRVVNVHDVVPKSPGLFLNESRPHALMKIAEGLPWCYSHVGEELALD
HQNSPFLKPSVDVSTAHNLEAMLHLLDGYHGKGERFVLSSGRDHALVNKASDFLKEHLQI
PPFWRQDANKGMVRNSEGRWIQAERLRFEDHHSPDIHHHLSQLRLDHPC

www.000webhost.com

Other information
Ka divergence:-0.00173695KaKs divergence:0.291255
GC content 1 (%):53GC content 2 (%):48GC content divergence:-0.05
Length 1 (bp):1548Length 2 (bp):1590Length divergence:0.013
MFE 1 (kcal):-548.32MFE 2 (kcal):-527.4MFE divergence-0.019