Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G06830-AT2G30540
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Glutaredoxin family protein
Function (paralog2):Thioredoxin superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-2.1156334776795
Log2 mRNA fold difference:-2.5913660694977
Log2 TE fold difference:0.4667829742444
Sequences
Protein sequence

MDKVMRMSSEKGVVIFTKSSCCLSYAVQVLFQDLGVNPKIHEIDKDPECREIEKALMRLG
CSKPVPAVFIGGKLVGSTNEVMSMHLSSSLVPLVKPYLC

MDKVVRMSSEKGVVIFSKSSCCMSYAVQVLFQDLGVHPTVHEIDKDPECREIEKALMRLG
CSTPVPAIFVGGKLIGSTNEVMSLHLSGSLVPLVKPFQANLC

Other information
Ka divergence:-0.0874023KaKs divergence:-0.999931
GC content 1 (%):46GC content 2 (%):48GC content divergence:0.021
Length 1 (bp):300Length 2 (bp):309Length divergence:0.015
MFE 1 (kcal):-85.72MFE 2 (kcal):-92MFE divergence0.035