Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G06870-AT2G30440
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Peptidase S24/S26A/S26B/S26C family protein
Function (paralog2):thylakoid processing peptide

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.10175591450256
Log2 mRNA fold difference:1.0340095008771
Log2 TE fold difference:-1.1701505896257
Sequences
Protein sequence

MAIRVTFTYSSYVARSIASSAGTRVGTGDVRSCFETWVRPRFCGHNQIPDIVDKSPGSNT
WGPSSGPRARPASSMYSTIAREILEEGCKSPLVLGMISLMNLTGAPQFSGMTGLGISPFK
TSSVIPFLRGSKWMPCSIPATLSTDIAEVDRGGKVCDPKVKLELSDKVSNGGNGWVNKLL
NICSEDAKAAFTAVTVSLLFRSALAEPKSIPSTSMLPTLDVGDRVIAEKVSYFFRKPEVS
DIVIFKAPPILVEHGYSCADVFIKRIVASEGDWVEVCDGKLLVNDTVQAEDFVLEPIDYE
MEPMFVPEGYVFVLGDNRNKSFDSHNWGPLPIKNIIGRSVFRYWPPSKVSDIIHHEQVSQ
KRAVDVS

MAIRITFTYSTHVARNLVGTRVGPGGYCFESLVRPRFFSHKRDFDRSPRNRPASMYGSIA
RELIGEGSQSPLVMGLISILKSTTGHESSTMNVLGVSSFKASSIIPFLQGSKWIKNPPVI
DDVDKGGTVCDDDDDKESRNGGSGWVNKLLSVCSEDAKAAFTAVTVSILFRSALAEPKSI
PSTSMYPTLDKGDRVMAEKVSYFFRKPEVSDIVIFKAPPILLEYPEYGYSSNDVFIKRIV
ASEGDWVEVRDGKLFVNDIVQEEDFVLEPMSYEMEPMFVPKGYVFVLGDNRNKSFDSHNW
GPLPIENIVGRSVFRYWPPSKVSDTIYHDQAITRGPVAVS

www.000webhost.com

Other information
Ka divergence:-0.0196819KaKs divergence:-0.307868
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):1104Length 2 (bp):1023Length divergence:-0.038
MFE 1 (kcal):-347.3MFE 2 (kcal):-323.7MFE divergence-0.035