Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G06890-AT2G30460
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):nodulin MtN21 /EamA-like transporter family protein
Function (paralog2):Nucleotide/sugar transporter family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.0344612222129
Log2 mRNA fold difference:-1.3680204997286
Log2 TE fold difference:-0.56816847444331
Sequences
Protein sequence

MSEGQKFQLGTIGALSLSVVSSVSIVICNKALISTLGFTFATTLTSWHLLVTFCSLHVAL
WMKMFEHKPFDPRAVMGFGILNGISIGLLNLSLGFNSVGFYQMTKLAIIPCTVLLETLFF
RKKFSRKIQFSLTILLLGVGIATVTDLQLNMLGSVLSLLAVVTTCVAQIMTNTIQKKFKV
SSTQLLYQSCPYQAITLFVTGPFLDGLLTNQNVFAFKYTSQVVFFIVLSCLISVSVNFST
FLVIGKTSPVTYQVLGHLKTCLVLAFGYVLLRDPFDWRNILGILVAVIGMVVYSYYCSIE
TQQKASETSTQLPQMKESEKDPLIAAENGSGVLSDGGGGVQQKTVAPVWNSNKDFQA

MSDAQKFQLGTIGALSLSVVSSVSIVICNKALISTLGFTFATTLTSWHLLVTFCSLHVAL
WMKFFEHKPFDPRAVLGFGVLNGISIGLLNLSLGFNSVGFYQMTKLAIIPCTVVLETIFF
RKMFSRKIQFSLVILLLGVGIATVTDLQLNMLGSVLSLLAVITTCVAQIMTNTIQKKYKV
SSTQLLYQSCPYQAITLFVTGPFLDGLLTNQNVFAFKYTSQVVFFIVLSCLISVSVNFST
FLVIGKTSPVTYQVLGHLKTCLVLAFGYLLLKDAFSWRNILGILVAVIGMVLYSYYCTLE
TQQKATETSTQLPQMDENEKDPLVSAENGSGLISDNGVQKQDPVWNSNKDFQA

Other information
Ka divergence:0.482659KaKs divergence:0.536723
GC content 1 (%):44GC content 2 (%):41GC content divergence:-0.035
Length 1 (bp):1074Length 2 (bp):1062Length divergence:-0.006
MFE 1 (kcal):-305.6MFE 2 (kcal):-289.81MFE divergence-0.027