Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G06923-AT2G30395
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):ovate family protein 17

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.8979427392713
Log2 mRNA fold difference:1.2061641715865
Log2 TE fold difference:0.69977832710377
Sequences
Protein sequence

MRLKSSLISLKSKLSKSCNRFISFFHARFRNVNTTQSSSSSLLSRLCFLNTNKEQRMSQI
RPRNSPSSLIDDSKLLHSRKMFPLAMTQRNKKARTSQRHMLKEDGVKEACRRFENYMIHM
FVEDGKIDDLMDMEELLYYWKNLNSPIFIDLVTRFYGELCTDLFPSDHDD

MRVKATLINFKSKLSKSCNRFVSLFRFRVKRPVFIRPLRARHGNVKPRHQHHHSKKPICS
CLCFLNSSKNHKMSNAKHRSSSFSVNDDDYSKFMQSPLTPATAKKLFTSPITTPYSSRTR
KSLNARDTFEDNAVEDACRSFENYLIHLIVEEGKIDDLMDIEELLFCWKNLKSPVFIELV
SRFYGELCRDLFSGE

Other information
Ka divergence:-0.326666KaKs divergence:-0.170022
GC content 1 (%):39GC content 2 (%):40GC content divergence:0.013
Length 1 (bp):513Length 2 (bp):588Length divergence:0.068
MFE 1 (kcal):-148.41MFE 2 (kcal):-141.92MFE divergence-0.022