Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G06960-AT2G30260
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RNA-binding (RRM/RBD/RNP motifs) family protein
Function (paralog2):U2 small nuclear ribonucleoprotein B

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.547476103363
Log2 mRNA fold difference:0.16952564265897
Log2 TE fold difference:1.4619864907048
Sequences
Protein sequence

MLTADIPPNQSIYIKHINEKIKKEELKRSLYCLFSQFGRLLDVVALKTPKLRGQAWVVFT
EVTAASNAVRQMQNFPFYDKPMRIQYAKSKSDYVTKAEGSFVPKEKKMKQEEKVERKRHA
EETQQPSMPNGATTQNGMPVPPFQPSGQDTMPPNNILFIHNLPIETNSMMLQLLFEQYPG
FKEIRMIEAKPGIAFVEYEDDVQSSMAMQALQGFKITPQNPMVVSFAKK

MLTADIPPNQSIYIQNLNERIKKEELKRSLYCLFSQFGRILDVVALKTPKLRGQAWVTFS
EVTAAGHAVRQMQNFPFYDKPMRLQYAKAKSDCLAKAEGTFVPKDKKRKQEEKVERKRED
SQRPNTANGPSANGPSANNGVPAPSFQPSGQETMPPNNILFIQNLPHETTSMMLQLLFEQ
YPGFKEIRMIDAKPGIAFVEYEDDVQASIAMQPLQGFKITPQNPMVISFAKK

www.000webhost.com

Other information
Ka divergence:-0.0221237KaKs divergence:0.225468
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):690Length 2 (bp):699Length divergence:0.006
MFE 1 (kcal):-193.14MFE 2 (kcal):-176.57MFE divergence-0.045