Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G06980-AT2G30230
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.2050092445499
Log2 mRNA fold difference:2.3164418457772
Log2 TE fold difference:-0.28891468718313
Sequences
Protein sequence

MGNSLRCCLACVLPCGALDLIRIVHLNGYVEEITRSITAGEILQANPNHVLSKPCSQGVV
RKILILSPESELKRGSIYFLIPDSSLPEKKRRRKDTPRRKKNLQNPSADAAGREIKGDEE
CVKLCEKYLEEVVSSASTGKEHRHRRRHSRSASVSTWRPLLDSISEDLN

MGNSLRCCLACVLPCGALDLIRIVHLNGHVDEITSPMTAGEILQANPNHVLSKPCSQGVV
RKILILSPESELKRGSIYFLIPDTSMPEKKKTKKRKELRCRKKPLESGNDINSDHVSTNK
DLDGHCLTLCEKYLEDVMLSEKMSSAGKENRHRRKHSRSASVSTWRPHLDSITEDLN

www.000webhost.com

Other information
Ka divergence:-0.307621KaKs divergence:-0.252123
GC content 1 (%):49GC content 2 (%):45GC content divergence:-0.043
Length 1 (bp):510Length 2 (bp):534Length divergence:0.023
MFE 1 (kcal):-163.5MFE 2 (kcal):-157.7MFE divergence-0.018