Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G07140-AT2G30060
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Pleckstrin homology (PH) domain superfamily protein
Function (paralog2):Pleckstrin homology (PH) domain superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.1140150322211
Log2 mRNA fold difference:-1.9392110353904
Log2 TE fold difference:0.8162863257384
Sequences
Protein sequence

MATNEPEHEHRDEEEAGANEDEDTGAQVAPIVRLEEVAVTTGEEDEDAVLDLKSKLYRFD
KDANQWKERGAGTVKFLKHKNTGKIRLVMRQSKTLKICANHFVKSGMSVQEHVGNEKSCV
WHARDFADGELKDELFCIRFASIENCKTFMQKFKEVAESEEEKEESKDAADTAGLLEKLT
VEETKTEEKTEAKAVETAKTEVKAEEKKESEAEKSGEAKKTEESGPST

MASISNEPERENRDEEETGANEDEDTGAQVAPIVRLEEVAVTTGEEDEDTILDLKSKLYR
FDKDGSQWKERGAGTVKFLKHRVSGKIRLVMRQSKTLKICANHLVGSGMSVQEHAGNDKS
CVWHARDFSDGELKDELFCIRFASVENCKAFMQKFKEVAESEEEKEESKDASDTAGLLEK
LTVEEKESEKKPVEKAEENKKSEAVEEKKTEESVPSA

Other information
Ka divergence:0.161179KaKs divergence:0.252452
GC content 1 (%):46GC content 2 (%):44GC content divergence:-0.022
Length 1 (bp):687Length 2 (bp):654Length divergence:-0.025
MFE 1 (kcal):-205.67MFE 2 (kcal):-195MFE divergence-0.027