Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G07150-AT2G30040
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):mitogen-activated protein kinase kinase kinase 13
Function (paralog2):mitogen-activated protein kinase kinase kinase 14

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.10350002915527
Log2 mRNA fold difference:-0.18584543681018
Log2 TE fold difference:0.15208706323405
Sequences
Protein sequence

MEKQSIRNTCSSSLMLSSPSSFWVRGACIGRGCFGAVSTAISKTNGEVFAVKSVDLATSL
PTQSESLENEISVFRSLKPHPYIVKFLGDGVSKEGTTTFRNLYLEYLPNGDVASHRAGGK
IEDETLLQRYTACLVSALRHVHSQGFVHCDVKARNILVSQSSMVKLADFGSAFRIHTPRA
LITPRGSPLWMAPEVIRREYQGPESDVWSLGCTIIEMFTGKPAWEDHGIDSLSRISFSDE
LPVFPSKLSEIGRDFLEKCLKRDPNQRWSCDQLLQHPFLSQCHNSSPTESSPRCVLDWVN
SGFDLEEEEEEVGRSEFEDAAKAIICNLATTGGVIWESDGWVEVRCHASEEEGTTMEYSG
STRVESEYNTSSDPNDDVAGDSAIIDVSMSQNLPPGNGGSAAALPYEFVVVLHLLMEIMV
YTTCIFREIVLTMYLLYQYNQSNKLETLSFNHSLKFCLFAHVIRIGQNYLLRGEMRSSVL
ITSHCLILITLVYSQIVVF

MEKQNIISNTSSSSSSWIRGSCVGRGCFGTVSKALSKIDGGLFAVKSIDLATCLPSQAES
LENEIVILRSMKSHPNIVRFLGDDVSKEGTASFRNLHLEYSPEGDVANGGIVNETLLRRY
VWCLVSALSHVHSNGIVHCDVKSKNVLVFNGGSSVKLADFGSAVEFEKSTIHVSPRGSPL
WMAPEVVRREYQGPESDVWSLGCTVIEMLTGKPAWEDHGFDSLSRIGFSNDLPFIPVGLS
ELGRDFLEKCLKRDRSQRWSCDQLLQHPFLCQDHHDSFFTESSPRCVLDWVNSEFDEEEE
SDEWRPESMVSAMARISKLAITGGANWESNGWTEVRDTSEESEAKKEVLVSPRVELESYI
SLESSSDDSVRQPRNEESATELASAVTCEAILLVMILVVENIQIYATFYTSSIIMHILYC
CSCCCYYHYQNNNKKNNFSKSTSFILSLNFLFGIACDSDRSIY

Other information
Ka divergence:0.00538705KaKs divergence:-0.168204
GC content 1 (%):47GC content 2 (%):43GC content divergence:-0.044
Length 1 (bp):1500Length 2 (bp):1392Length divergence:-0.037
MFE 1 (kcal):-497.2MFE 2 (kcal):-458.34MFE divergence-0.041