Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G07160-AT2G30020
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein phosphatase 2C family protein
Function (paralog2):Protein phosphatase 2C family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:1.8065013475486
Log2 mRNA fold difference:2.5932462385665
Log2 TE fold difference:-0.71952554611272
Sequences
Protein sequence

MSSSVAVCNSPVFSPSSSLFCNKPLNTSPAHETLTLSLSHLNPPVSSTSPSAASPTSPFC
LRLLKPPAKLGFGSDSGPGSILKRKRPTTLDIPVAPVGIAAPISNADTPREESRAVEREG
DGYSVYCKRGKREAMEDRFSAITNLQGDPKQAIFGVYDGHGGPTAAEFAAKNLCSNILGE
IVGGRNESKIEEAVKRGYLATDSEFLKEKNVKGGSCCVTALISDGNLVVANAGDCRAVLS
VGGFAEALTSDHRPSRDDERNRIESSGGYVDTFNSVWRIQGSLAVSRGIGDAHLKQWIIS
EPEINILRINPQHEFLILASDGLWDKVSNQEAVDIARPFCKGTDQKRKPLLACKKLVDLS
VSRGSLDDISVMLIQLCHLF

MSCSVAVCNSPVFSPSSSLFCNKSSILSSPQESLSLTLSHRKPQTSSPSSPSTTVSSPKS
PFRLRFQKPPSGFAPGPLSFGSESVSASSPPGGVLKRKRPTRLDIPIGVAGFVAPISSSA
AVAATPREECREVEREGDGYSVYCKRGRREAMEDRFSAITNLHGDRKQAIFGVYDGHGGV
KAAEFAAKNLDKNIVEEVVGKRDESEIAEAVKHGYLATDASFLKEEDVKGGSCCVTALVN
EGNLVVSNAGDCRAVMSVGGVAKALSSDHRPSRDDERKRIETTGGYVDTFHGVWRIQGSL
AVSRGIGDAQLKKWVIAEPETKISRIEHDHEFLILASDGLWDKVSNQEAVDIARPLCLGT
EKPLLLAACKKLVDLSASRGSSDDISVMLIPLRQFI

www.000webhost.com

Other information
Ka divergence:-0.142829KaKs divergence:-0.510112
GC content 1 (%):48GC content 2 (%):46GC content divergence:-0.021
Length 1 (bp):1143Length 2 (bp):1191Length divergence:0.021
MFE 1 (kcal):-365.42MFE 2 (kcal):-384.21MFE divergence0.025