Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G07170-AT2G30000
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):PHF5-like protein
Function (paralog2):PHF5-like protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.18237406691613
Log2 mRNA fold difference:-1.2441432998349
Log2 TE fold difference:1.3346150058512
Sequences
Protein sequence

MAKHHPDLIMCRKQPGIAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSFQGRCVI
CGGVGISDAYYCKECTQQEKDRDGCPKIVNLGSAKTDLFYERKKYGFKKR

MAKHHPDLIMCRKQPGIAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSFQGRCVI
CGGVGISDAYYCKECTQQEKDRDGCPKIVNLGSAKTDLFYERKKYGFKKR

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):333Length 2 (bp):333Length divergence:0
MFE 1 (kcal):-89.97MFE 2 (kcal):-86MFE divergence-0.023