Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G07175-AT2G29995
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-1.8945847957556
Log2 mRNA fold difference:-0.051361905216469
Log2 TE fold difference:-1.8703099750241
Sequences
Protein sequence

MVFCYAIRLCLCIFLALSIVSSARLTFSFSENEKMMVRGRSLMVSTNDYGEPSANAKHNP
PGRRRGGGRRG

MGYSSSSRIGLCLFLFFTFALLSSARISLSFSENEMTVVPERSLMVSTNDYSDPTANGRH
DPPRGGRGRRR

www.000webhost.com

Other information
Ka divergence:0.167177KaKs divergence:0.384444
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):216Length 2 (bp):216Length divergence:0
MFE 1 (kcal):-57.75MFE 2 (kcal):-63.4MFE divergence0.047