Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G07180-AT2G29990
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):alternative NAD(P)H dehydrogenase 1
Function (paralog2):alternative NAD(P)H dehydrogenase 2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.041188037085
Log2 mRNA fold difference:-2.6215057286973
Log2 TE fold difference:1.4312501398777
Sequences
Protein sequence

MLWIKNLARISQTTSSSVGNVFRNPESYTLSSRFCTALQKQQVTDTVQAKEDVVNALEPQ
RYDGLAPTKEGEKPRVLVLGSGWAGCRVLKGIDTSIYDVVCVSPRNHMVFTPLLASTCVG
TLEFRSVAEPISRIQPAISREPGSYYFLANCSKLDADNHEVHCETVTEGSSTLKPWKFKI
AYDKLVLACGAEASTFGINGVLENAIFLREVHHAQEIRRKLLLNLMLSEVPGIGEDEKKR
LLHCVVVGGGPTGVEFSGELSDFIMKDVRQRYSHVKDDIRVTLIEARDILSSFDDRLRHY
AIKQLNKSGVKLVRGIVKEVKPQKLILDDGTEVPYGPLVWSTGVGPSSFVRSLDFPKDPG
GRIGIDEWMRVPSVQDVFAIGDCSGYLESTGKSTLPALAQVAEREGKYLANLFNVMGKAG
GGRANSAKEMELGEPFVYKHLGSMATIGRYKALVDLRESKEGKGISMAGFLSWFIWRSAY
LTRVVSWRNRFYVAINWLTTFVFGRDISRI

MFMIKNLTRISPNTSSIITRFRNSGSSSLSYTLASRFCTAQETQIQSPAKIPNDVDRSQY
SGLPPTREGEKPRVVVLGSGWAGCRLMKGIDTNLYDVVCVSPRNHMVFTPLLASTCVGTL
EFRSVAEPISRIQPAISREPGSFFFLANCSRLDADAHEVHCETLTDGLNTLKPWKFKIAY
DKLVIASGAEASTFGIHGVMENAIFLREVHHAQEIRRKLLLNLMLSDTPGISKEEKRRLL
HCVVVGGGPTGVEFSGELSDFIMKDVRQRYAHVKDDIHVTLIEARDILSSFDDRLRRYAI
KQLNKSGVRFVRGIVKDVQSQKLILDDGTEVPYGLLVWSTGVGPSPFVRSLGLPKDPTGR
IGIDEWMRVPSVQDVFAIGDCSGYLETTGKPTLPALAQVAEREGKYLANLLNAIGKGNGG
RANSAKEIELGVPFVYKHLGSMATIGRYKALVDLRESKDAKGISMTGFVSWFIWRSAYLT
RVISWRNRFYVAINWFTTFVFGRDISRI

www.000webhost.com

Other information
Ka divergence:0.105492KaKs divergence:0.106176
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):1533Length 2 (bp):1527Length divergence:-0.002
MFE 1 (kcal):-500.28MFE 2 (kcal):-486.68MFE divergence-0.014