Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G07200-AT2G29970
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein
Function (paralog2):Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.52322452539305
Log2 mRNA fold difference:-1.2469402496801
Log2 TE fold difference:0.69548882592353
Sequences
Protein sequence

MPTPVTTARECLTEEAARALDDAVVVARRRSHAQTTSLHAVSALLAMPSSILREVCVSRA
ARSVPYSSRLQFRALELCVGVSLDRLPSSKSPATEEDPPVSNSLMAAIKRSQANQRRHPE
SYHLQQIHASNNGGGGCQTTVLKVELKYFILSILDDPIVNRVFGEAGFRSSEIKLDVLHP
PVTQLSSRFSRGRCPPLFLCNLPNSDPNREFPFSGSSGFDENSRRIGEVLGRKDKKNPLL
IGNCANEALKTFTDSINSGKLGFLQMDISGLSLISIEKEISEILADGSKNEEEIRMKVDD
LGRTVEQSGSKSGIVLNLGELKVLTSEANAALEILVSKLSDLLKHESKQLSFIGCVSSNE
TYTKLIDRFPTIEKDWDLHVLPITASTKPSTQGVYPKSSLMGSFVPFGGFFSSTSNFRVP
LSSTVNQTLSRCHLCNEKYLQEVAAVLKAGSSLSLADKCSEKLAPWLRAIETKEDKGITG
SSKALDDANTSASQTAALQKKWDNICQSIHHTPAFPKLGFQSVSPQFPVQTEKSVRTPTS
YLETPKLLNPPISKPKPMEDLTASVTNRTVSLPLSCVTTDFGLGVIYASKNQESKTTREK
PMLVTLNSSLEHTYQKDFKSLREILSRKVAWQTEAVNAISQIICGCKTDSTRRNQASGIW
LALLGPDKVGKKKVAMTLSEVFFGGKVNYICVDFGAEHCSLDDKFRGKTVVDYVTGELSR
KPHSVVLLENVEKAEFPDQMRLSEAVSTGKIRDLHGRVISMKNVIVVVTSGIAKDNATDH
VIKPVKFPEEQVLSARSWKLQIKLGDATKFGVNKRKYELETAQRAVKVQRSYLDLNLPVN
ETEFSPDHEAEDRDAWFDEFIEKVDGKVTFKPVDFDELAKNIQEKIGSHFERCFGSETHL
ELDKEVILQILAASWSSLSSGEEEGRTIVDQWMQTVLARSFAEAKQKYGSNPMLGVKLVA
SSSGLASGVELPAKVDVIW

MPTPVTTARQCLTEETARALDDAVSVARRRSHAQTTSLHAVSGLLTMPSSILREVCISRA
AHNTPYSSRLQFRALELCVGVSLDRLPSSKSTPTTTVEEDPPVSNSLMAAIKRSQATQRR
HPETYHLHQIHGNNNTETTSVLKVELKYFILSILDDPIVSRVFGEAGFRSTDIKLDVLHP
PVTSQFSSRFTSRSRIPPLFLCNLPESDSGRVRFGFPFGDLDENCRRIGEVLARKDKKNP
LLVGVCGVEALKTFTDSINRGKFGFLPLEISGLSVVSIKISEVLVDGSRIDIKFDDLGRL
KSGMVLNLGELKVLASDVFSVDVIEKFVLKLADLLKLHREKLWFIGSVSSNETYLKLIER
FPTIDKDWNLHLLPITSSSQGLYPKSSLMGSFVPFGGFFSSTSDFRIPSSSSMNQTLPRC
HLCNEKYEQEVTAFAKSGSMIDDQCSEKLPSWLRNVEHEHEKGNLGKVKDDPNVLASRIP
ALQKKWDDICQRIHQTPAFPKLSFQPVRPQFPLQLGSSSQTKMSLGSPTEKIVCTRTSES
FQGMVALPQNPPHQPGLSVKISKPKHTEDLSSSTTNSPLSFVTTDLGLGTIYASKNQEPS
TPVSVERRDFEVIKEKQLLSASRYCKDFKSLRELLSRKVGFQNEAVNAISEIVCGYRDES
RRRNNHVATTSNVWLALLGPDKAGKKKVALALAEVFCGGQDNFICVDFKSQDSLDDRFRG
KTVVDYIAGEVARRADSVVFIENVEKAEFPDQIRLSEAMRTGKLRDSHGREISMKNVIVV
ATISGSDKASDCHVLEEPVKYSEERVLNAKNWTLQIKLADTSNVNKNGPNKRRQEEAETE
VTELRALKSQRSFLDLNLPVDEIEANEDEAYTMSENTEAWLEDFVEQVDGKVTFKLIDFD
ELAKNIKRNILSLFHLSFGPETHLEIENDVILKILAALRWSSDEEKTFDQWLQTVLAPSF
AKARQKCVPAAPFSVKLVASRESPAEEETTGIQQFPARVEVI

Other information
Ka divergence:-0.0495968KaKs divergence:-0.124861
GC content 1 (%):46GC content 2 (%):43GC content divergence:-0.034
Length 1 (bp):2940Length 2 (bp):3009Length divergence:0.012
MFE 1 (kcal):-958.87MFE 2 (kcal):-905.98MFE divergence-0.028