Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G07240-AT1G07250
Species:Arabidopsis
Duplication type:TD
Function (paralog1):UDP-glucosyl transferase 71C5
Function (paralog2):UDP-glucosyl transferase 71C4

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.7196145352351
Log2 mRNA fold difference:0.61324144678008
Log2 TE fold difference:-1.3767055162995
Sequences
Protein sequence

MKTAELIFVPLPETGHLLSTIEFGKRLLNLDRRISMITILSMNLPYAPHADASLASLTAS
EPGIRIISLPEIHDPPPIKLLDTSSETYILDFIHKNIPCLRKTIQDLVSSSSSSGGGSSH
VAGLILDFFCVGLIDIGREVNLPSYIFMTSNFGFLGVLQYLPERQRLTPSEFDESSGEEE
LHIPAFVNRVPAKVLPPGVFDKLSYGSLVKIGERLHEAKGILVNSFTQVEPYAAEHFSQG
RDYPHVYPVGPVLNLTGRTNPGLASAQYKEMMKWLDEQPDSSVLFLCFGSMGVFPAPQIT
EIAHALELIGCRFIWAIRTNMAGDGDPQEPLPEGFVDRTMGRGIVCSWAPQVDILAHKAT
GGFVSHCGWNSVQESLWYGVPIATWPMYAEQQLNAFEMVKELGLAVEIRLDYVADGDRVT
LEIVSADEIATAVRSLMDSDNPVRKKVIEKSSVARKAVGDGGSSTVATCNFIKDILGDHF

MVKETELIFIPVPSTGHILVHIEFAKRLINLDHRIHTITILNLSSPSSPHASVFARSLIA
SQPKIRLHDLPPIQDPPPFDLYQRAPEAYIVKLIKKNTPLIKDAVSSIVASRRGGSDSVQ
VAGLVLDLFCNSLVKDVGNELNLPSYIYLTCNARYLGMMKYIPDRHRKIASEFDLSSGDE
ELPVPGFINAIPTKFMPPGLFNKEAYEAYVELAPRFADAKGILVNSFTELEPHPFDYFSH
LEKFPPVYPVGPILSLKDRASPNEEAVDRDQIVGWLDDQPESSVVFLCFGSRGSVDEPQV
KEIARALELVGCRFLWSIRTSGDVETNPNDVLPEGFMGRVAGRGLVCGWAPQVEVLAHKA
IGGFVSHCGWNSTLESLWFGVPVATWPMYAEQQLNAFTLVKELGLAVDLRMDYVSSRGGL
VTCDEIARAVRSLMDGGDEKRKKVKEMADAARKALMDGGSSSLATARFIAELFEDGSSC

www.000webhost.com

Other information
Ka divergence:-0.0387144KaKs divergence:-0.0860892
GC content 1 (%):49GC content 2 (%):50GC content divergence:0.01
Length 1 (bp):1443Length 2 (bp):1440Length divergence:-0.001
MFE 1 (kcal):-486.85MFE 2 (kcal):-500.14MFE divergence0.013