Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G07270-AT2G29680
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Cell division control, Cdc6
Function (paralog2):cell division control 6

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:1.3414234800741
Log2 mRNA fold difference:1.8484659217139
Log2 TE fold difference:-0.58203262054408
Sequences
Protein sequence

MPTNAGTSLSSYKHIVAIGTTVKSESLESAAYEIPRKRKMRSDSAAVSGNSVSTPKKLKS
HLPSSVPNPGMSEKEVVEDSNEILRYPVNLAVSDCLGTKSKWSPRDEEQMRAVKEALHVS
KAPSTILCREDEQIRIFEFVKGCIDQQKAGSLYICGCPGTGKSLSMEKVVQQVGDWSTQA
GLPPVDTLSVNCTSLSKTTDIFSKILGEIKPGKNANTNSSPLQHLQNLFSQKQESSSSRM
MLIIADEMDYLITKDRGVLYDLFMLTTLPFSRCILIGVANAIDLADRFLPKLKSLNCKPM
VITFRAYSKDQILRILQERLRVLSYVAFQPKALELCARKVAAASGDMRKALCVCRSALEI
LEIETRGSTGPESQGPTPDDSVVRMDHMAAALSKTFKSPVVETIQSLPQHQQIIICAAAK
AFRGSKKDATVGELNKLYLEICKSWMISPAGITEFTNMCTVLNDQGILKVGQARRDKLKR
VSLRVDESDITFALQEIRFFRNCLL

MPAIAGPSSSPQKHVVGSRSESIGGVRSAEVNTSRKRKLISDSAAEVSATVVLPVNSIST
PMKWKSPRRCAVSIPKTSDEEIKEDSNEKLENPVISVCLEVKSKWNPKDDEQMKAVKEAL
HVSKAPSTVVCREDEQRRVFEFVKGCMEQKKAGSLYICGCPGTGKSLSMEKVRLQAEEWA
KQAGLHCPETVSVNCTSLTKSTDIFSKILGNYESGKKANGSFSPLQQLQRLFSQKQQQSR
SKMMLIIADEMDYLITRDRGVLHELFMLTTLPLSRCILIGTVFCVINVHFLKSVSYGQTS
FKFKVRICPPGVANAIDLADRFLPKLKSLNCKPLVVTFRAYSKDQILRILQERLVALPFV
AFQSNALEICARKVSAASGDMRKALCVCRSALEILEIEVRGSIDQEPKGPVPECQVVKMD
HMIAALSKTFKSPIVDTIQSLPQHQQIIVCSAAKAFRGSKKDRTIAELNKLYLEICKSSM
ITPAGITEFSNMCTVLNDQGILKLSLARDDKLKRVSLRVDEADITFALKEIRFFRNCLL

www.000webhost.com

Other information
Ka divergence:-0.0839638KaKs divergence:0.406
GC content 1 (%):41GC content 2 (%):40GC content divergence:-0.012
Length 1 (bp):1518Length 2 (bp):1620Length divergence:0.033
MFE 1 (kcal):-451.65MFE 2 (kcal):-456.6MFE divergence0.005