Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G07280-AT2G29670
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Tetratricopeptide repeat (TPR)-like superfamily protein
Function (paralog2):Tetratricopeptide repeat (TPR)-like superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.2985343363539
Log2 mRNA fold difference:0.65989963415906
Log2 TE fold difference:-1.7106748915728
Sequences
Protein sequence

MGVKVATSSTFHQWVAHPIVHHSSSLSQTLASSAVSSPSRRRIIGNDGRSSLSCRSVMQS
QRLNPSSPFGTSSTNLRHSKSCELWESTKRPKTQLIRRAFSANVDPFSEEEFAKKMQELT
LKFQVSNEEEDNESDTRIDDYTRKMDIVGSHNNFRSDSMEPPWPEMVQMSNIERKANSVD
LPLSLRIIKRKLQMEEGVLNQVGESACCSVKKAFSSMVFMIRELQSFTLHMRELLLFEDL
QGILHRVRKEMQASFVWLFQQVFSATPTLMVSVMILLANFTVYSIESNSALAAAVSPPTT
LSFSFETTAEISETQETNQKFDSSMVKTFSVSSPYGKTSFVGGGGGNNIPPPVQSGTDGD
GSDQFRKSQFSSSSLGATSADSDVSVSGQEEIRLWNSILEETAKMETLDHETMKGMVSPV
EARLEAEESMDYFKTELLYQTGLSQEPGNVLLLANYAQFLYLIIHDYDRAEKYFKRAAKA
EPADAEALNKYATFLWRARNDIWRAEETYLEAISADPTNSVYSANYAHFLWNTGGDETCF
PLDAPSQQNNTT

MGVKVASSSTFLQWTTQPIIHQSSSPSQTLASGTITSPSKRRSTVHDGRFLSCRFVTQRL
NRSALFGTPSTKLHRPKSCELWKSSSSSSRPIKTQSFRRVYSANLDPFSDEEFSKKIQEL
TLRFNIPHHDDDENSIEPPWNEMVHLSSIEMKANSVDLPLSLRIIKKKRQWEEGVKQAGE
SACCSMNKAFSSMVFMIRELQSFTLHMREILFYEDLQEILLRVREEMQQSFVWLFQQVFS
ATPTLMVYVMILLANFTVYSIGNNSSALAAVAPLPPTITELTTVSETEETNVKFDSSVVK
TFFVSSPSGSIASVGGNNNGGGGNVKPVLSGTDGDGSDGSEQFRTIIPEGVSQLSSSNFG
SEPSVSGQDEHRLWNSMVEEAERMQYSNIDDSLDQETRKRFVSHVEARVEAEEDTGYFKT
ELMYQTELSQEPNNPLLLANYAQFLYLVSNDHDRAEEYFKRAVGVEPKDAEAFSKYATFL
WRARDDLWAAEETFLEAIDADPTNSYYAANYANFLWNTGGDDTCFPLDDESHEDTI

Other information
Ka divergence:-0.0267133KaKs divergence:-0.141277
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1659Length 2 (bp):1611Length divergence:-0.015
MFE 1 (kcal):-509.91MFE 2 (kcal):-477.32MFE divergence-0.033