Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G07300-AT2G29640
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):josephin protein-related
Function (paralog2):JOSEPHIN-like protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.73786436701052
Log2 mRNA fold difference:-0.046148824081367
Log2 TE fold difference:-0.98396374589594
Sequences
Protein sequence

MSATGIKRSNLNTRPVQRDASAKQTAIKGPYGKSPGCTTSCGLRLPRKTEVTAAKLIKHL
GCKFAKGLRLVVMRKKKRSPPSKVSSFSGRSQPPIIPINNDSHRSEAIEDCIQFINSSSS
FTRSNSTS

MADSESKIYHERQRLQFCLLHCLNNLFQDKDAFTKESLNSIAEKLETNDPNKETWTPLSF
VLKPHHNTITGNYDVNVMITALEGKGKSVVWHDKRIGASSIDLDDADTLMGIVLNVPVKR
YGGLWRSRHWVVVRKINGVWYNLDSDLVVPQLFRDDDEVRGFLDQNLSLDVIGLIWNLPY
NANQLPLASNYRVVITHWSDLNGMFSHVTNYPLDFDVYPQVSSKVSAIYKATGTKRFNAN
TRPVTPGKQSSVKGPYYKNPGCTTSCGLRLPRKTECTAARLIKDLSCKFVMGLRLVVMRK
KKKKRSPPLKKASSSGISQPSVISVVNDNNHRSAAIEDCIQFINSSSSFTRSNSTCGSKS

Other information
Ka divergence:0.513208KaKs divergence:0.999847
GC content 1 (%):44GC content 2 (%):40GC content divergence:-0.048
Length 1 (bp):387Length 2 (bp):1083Length divergence:0.473
MFE 1 (kcal):-103.74MFE 2 (kcal):-289.66MFE divergence0.473