Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G07360-AT2G29580
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):CCCH-type zinc fingerfamily protein with RNA-binding domain
Function (paralog2):CCCH-type zinc fingerfamily protein with RNA-binding domain

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-2.3883494292665
Log2 mRNA fold difference:-1.7191670746007
Log2 TE fold difference:-0.564660796106
Sequences
Protein sequence

MAHRILRDHEADGWERSDFPIICESCLGDNPYVRMTKANYDKECKICTRPFTVFRWRPGR
DARYKKTEICQTCCKLKNVCQVCLLDLEYGLPVQVRDTALNISTHDSIPKSDVNREYFAE
EHDRKARAGLDYESSFGKMRPNDTILKLQRTTPYYKRNRAHVCSFFIRGECTRGAECPYR
HEMPETGELSQQNIKDRYYGVNDPVAMKLLGKAGEMGTLESPDDESIKTLYVGGLNSRIL
EQDIRDQFYAHGEIESIRILADKACAFVTYTSREGAEKAAQELSNRLVINGQRLKLTWGR
PKPDQDGANQQGGVAHSGLLPRAVISQQHNQPPPMQQYYMHPPPANQDKPYYPSMDPQRM
GAVISTQEAGGSSTENNGASSSSYMMPPHQSYPPPPYGYMPSPYQQQYPPNHHHQPSPMQ
HYAPPPAAYPYPQQPGPGSRPAPSPTAVSAISPDSAPAGSGAPSGSSQQAPDVSTATGSS
Q

MAHRILRDHEADGWERSDFPIICESCLGDNPYVRMTKANYDKECKICTRPFTVFRWRPGR
DARYKKTEVCQTCCKLKNVCQVCLLDLEYGLPVQVRDTALNISTHDSIPKSDVNREFFAE
EHDRKTRAGLDYESSFGKIRPNDTIRMLQRTTPYYKRNRAHICSFFIRGECTRGDECPYR
HEMPETGELSQQNIKDRYYGVNDPVALKLLGKAGEMGTLESPEDQSIRTLYVGGLNSRVL
EQDIRDQFYAHGEIESIRILAEKACAFVTYTTREGAEKAAEELSNRLVVNGQRLKLTWGR
PQVPKPDQDGSNQQGSVAHSGLLPRAVISQQQNQPPPMLQYYMHPPPPQPPHQDRPFYPS
MDPQRMGAVSSSKESGSSTSDNRGASSSSYTMPPHGHYPQHQPYPPPSYGGYMQPPYQQY
PPYHHGHSQQADHDYPQQPGPGSRPNPPHPSSVSAPPPDSVSAAPSGSSQQSADAAVTTG
SSQ

www.000webhost.com

Other information
Ka divergence:0.514558KaKs divergence:-0.225806
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):1446Length 2 (bp):1452Length divergence:0.002
MFE 1 (kcal):-431.6MFE 2 (kcal):-424.61MFE divergence-0.008