Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G07370-AT2G29570
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):proliferating cellular nuclear antigen 1
Function (paralog2):proliferating cell nuclear antigen 2

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.052589748505513
Log2 mRNA fold difference:0.31642782445657
Log2 TE fold difference:-0.3400975720116
Sequences
Protein sequence

MLELRLVQGSLLKKVLESIKDLVNDANFDCSSTGFSLQAMDSSHVALVSLLLRSEGFEHY
RCDRNLSMGMNLGNMSKMLKCAGNDDIITIKADDGGDTVTFMFESPTQDKIADFEMKLMD
IDSEHLGIPDAEYHSIVRMPSNEFSRICKDLSSIGDTVVISVTKEGVKFSTAGDIGTANI
VLRQNTTVDKPEDAIVIEMKEPVSLSFALRYMNSFTKATPLSDTVTISLSSELPVVVEYK
VAEMGYIRYYLAPKIEEEEDTNP

MLELRLVQGSLLKKVLEAVKDLVNDANFDCSTTGFSLQAMDSSHVALVSLLLRSEGFEHY
RCDRNLSMGMNLGNMSKMLKCAGNDDIITIKADDGSDTVTFMFESPTQDKIADFEMKLMD
IDSEHLGIPDAEYHSIVRMPSGEFSRICKDLSSIGDTVVISVTKEGVKFSTAGDIGTANI
VLRQNTTVDKPEDAIVIEMNEPVSLSFALRYMNSFTKATPLSETVTISLSSELPVVVEYK
VAEMGYIRYYLAPKIEEEEDTKPE

Other information
Ka divergence:-0.159533KaKs divergence:-0.418868
GC content 1 (%):46GC content 2 (%):44GC content divergence:-0.022
Length 1 (bp):792Length 2 (bp):795Length divergence:0.002
MFE 1 (kcal):-242.5MFE 2 (kcal):-237MFE divergence-0.011