Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G07400-AT2G29500
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):HSP20-like chaperones superfamily protein
Function (paralog2):HSP20-like chaperones superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:1.8557661266242
Log2 mRNA fold difference:2.4262674283029
Log2 TE fold difference:-0.43746589806077
Sequences
Protein sequence

MSLIPSFFGNNRRSNSIFDPFSLDVWDPFKELQFPSSLSGETSAITNARVDWKETAEAHV
FKADLPGMKKEEVKVEIEDDSVLKISGERHVEKEEKQDTWHRVERSSGQFSRKFKLPENV
KMDQVKASMENGVLTVTVPKVEEAKKKAQVKSIDISG

MSMIPSFFNNNRRSNIFDPFSLDVWDPFKELTSSSLSRENSAIVNARVDWRETPEAHVFK
ADLPGLKKEEVKVEIEEDSVLKISGERHVEKEDKNDTWHRVERSSGQFTRRFRLPENVKM
DQVKAAMENGVLTVTVPKAETKKADVKSIQISG

www.000webhost.com

Other information
Ka divergence:-0.279188KaKs divergence:-0.229572
GC content 1 (%):51GC content 2 (%):46GC content divergence:-0.052
Length 1 (bp):474Length 2 (bp):462Length divergence:-0.013
MFE 1 (kcal):-149.32MFE 2 (kcal):-128.5MFE divergence-0.075