Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G07420-AT2G29390
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):sterol 4-alpha-methyl-oxidase 2-1
Function (paralog2):sterol 4-alpha-methyl-oxidase 2-2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.63083010891313
Log2 mRNA fold difference:-0.27807532527541
Log2 TE fold difference:-0.28930901304539
Sequences
Protein sequence

MASFVESGWQYLVTHFSDFQLACIGSFLLHESVFFLSGLPFIFLERQGFLSKYKIQTKNN
TPAAQGKCITRLLLYHFSVNLPLMLASYPVFRAMGMRSSFPLPSWKEVSAQILFYFIIED
FVFYWGHRILHSKWLYKNVHSVHHEYATPFGLTSEYAHPAEILFLGFATIVGPALTGPHL
ITLWLWMVLRVLETVEAHCGYHFPWSLSNFLPLYGGADFHDYHHRLLYTKSGNYSSTFVY
MDWIFGTDKGYRRLKTLKENGDMKQT

MDSLVESGWKYLVTHFSDFQLACIGSFILHESVFFLSGLPYIFLERTGFLSNYKIQTKSN
TPEAQGKCIARLLLYHCCVNLPLMMASYPVFRFMGMESSFPLPSWKVVSAQILFYFIIED
FVFYWGHRILHTKWLYKNVHSVHHEYATPFGLTSEYAHPAEILFLGFATIVGPALTGPHL
ITLWLWMMLRVIETVEAHCGYHFPWSPSNFLPLYGGSLILMWESFAYSADFHDYHHRLLY
TKSGNYSSTFVYMDWIFGTDKGYRKLKALKET

www.000webhost.com

Other information
Ka divergence:0.405156KaKs divergence:0.206144
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):801Length 2 (bp):819Length divergence:0.011
MFE 1 (kcal):-217.65MFE 2 (kcal):-216.2MFE divergence-0.003