Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G07470-AT1G07480
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Transcription factor IIA, alpha/beta subunit
Function (paralog2):Transcription factor IIA, alpha/beta subunit

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.12057730218067
Log2 mRNA fold difference:0.30005822515532
Log2 TE fold difference:-0.14428201474983
Sequences
Protein sequence

MGTTTTTSAVYIHVIEDVVNKVREEFINNGGPGESVLSELQGIWETKMMQAGVLNGPIER
SSAQKPTPGGPLTHDLNVPYEGTEEYETPTAEMLFPPTPLQTPLPTPLPGTADNSSMYNI
PTGSSDYPTPGTENGVNIDVKARPSPYMPPPSPWTNPRLDVNVAYVDGRDEPERGNSNQQ
FTQDLFVPSSGKRKRDDSSAHYQNGGSIPQQDGASDAIPEANFECAALRITYVGDRKIPR
DLIGSSSKIPQVDGPMPDPYDEMLSTPNIYSYQGPNEEFNEARTPAPNEIQTSTPVAVPN
DIIEDDEELLNEDDDDDELDDLESGEDMNTQHLVLAQFDKVTRTKSRWKCSLKDGIMHIN
DKDILFNKATGEFDF

MGTTTTTSAVYIHVIEDVVNKVREEFINNGGPGESVLSELQGIWETKMMQAGVLNGPIER
SSAQKPTPGGPLTHDLNVPYEGTEEYETPTAEMLFPPTPLQTPLPTPLPGTADNSSMYNI
PTGSSDYPTPGTENGVNIDVKARPSPYMPPPSPWTNPRLDVNVAYVDGRDEPERGNSNQQ
FTQDLFVPSSGKRKRDDSSGHYQNGGSIPQQDGAGDAIPEANFECDAFRITSIGDRKVPR
DFFSSSSKIPQVDGPMPDPYDEMLSTPNIYSYQGPSEEFNEARTPAPNEIQTSTPVAVQN
DIIEDDEELLNEDDDDDELDDLESGEDMNTQHLVLAQFDKVTRTKSRWKCSLKDGIMHIN
DKDILFNKAAGEFDF

Other information
Ka divergence:-0.148148KaKs divergence:-0.55741
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1128Length 2 (bp):1128Length divergence:0
MFE 1 (kcal):-338.07MFE 2 (kcal):-327.63MFE divergence-0.016