Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G07510-AT2G29080
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):FTSH protease 10
Function (paralog2):FTSH protease 3

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.8662882137431
Log2 mRNA fold difference:1.7337794449869
Log2 TE fold difference:0.097991166685278
Sequences
Protein sequence

MIFSKLGSSLARSSRSKGFVYGGGVRSAVFNQGRLRAPQNLEAAVNQVDGGLGFLRRHFA
SFAARKGLEAGDLSRAFANPRLRRFFSSQTPKKKNYENYYPKDSKKAPKNEQKSESRDGS
KKNENENAGDAFSNEYQNMLIPLMAIALILSTFSLGSREQQQISFQEFKNKLLEAGLVDH
IDVSNKEVAKVYVRSSPKSQTTEEVVQGPGNGVPAKGRGGQYKYYFNIGSVESFEEKLEE
AQEAIGVNSHDFVPVTYVSETIWYQELLRFAPTLLLVATLIFGARRMQGGLGGLGGPGGK
AGRGIFNIGKAQITRADKNSKNKIYFKDVAGCEEAKQEIMEFVHFLQNPKKYEDLGAKIP
KGALLVGPPGTGKTLLAKATAGESAVPFLSISGSDFMEMFVGVGPSRVRNLFQEARQCAP
SIIFIDEIDAIGRARGRGGFSGGNDERESTLNQLLVEMDGFGTTAGVVVLAGTNRPDILD
KALLRPGRFDRQITIDKPDIKGRDQIFQIYLKKIKLDHEPSYYSQRLAALTPGFAGADIA
NVCNEAALIAARHEGATVTMAHFDSAIDRVIGGLEKKNRVISKLERRTVAYHESGHAVAG
WFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGR
ISTGAQNDLEKVTKMTYAQVAVYGFSDKIGLLSFPQREDEFSKPYSNRTGAMIDEEVREW
VGKAYKRTVELIEEHKEQVAQIAELLLEKEVLHQDDLTKVLGERPFKSGETTNYDRFKSG
FEESEKESQKESVPVKPVEDDGIPPLEPQVVPT

MTMIFFSKLNRSISRSKGFLYGGGVRSAARLLTSPGLEAASVNEVEGGLGFIRRHFASLA
SRKGLVNNDLIGVFANPRLRRFFSDEAPKKKNYENYFPKDKQEPKSDQKSEHKEGSEKNE
NENVGDMFMNRFQNLLIPLLALAVFFSTFSFGSGEQQQISFQEFKNKLLEPGLVDHIDVS
NKSVAKVYVRSTPKDQQTTDVVHGNGNGIPAKRTGGQYKYYFNIGSVDSFEEKLEEAQEA
LGVDRHEYVPVTYVSEMVWYQEFMRFAPTLLLLGTLIYGARRMQGGLGVGGTGGKNGRGI
FNIGKATITRADKHSKNKIYFKDVAGCDEAKQEIMEFVHFLKNPKKYEDLGAKIPKGALL
VGPPGTGKTLLAKATAGESGVPFLSISGSDFMEMFVGVGPSRVRHLFQEARQAAPSIIFI
DEIDAIGRARGRGGLGGNDERESTLNQLLVEMDGFGTTAGVVVLAGTNRPDILDKALLRP
GRFDRQITIDKPDIKGRDQIFKIYLKKIKLDHEPSYYSQRLAALTPGFAGADIANVCNEA
ALIAARHEGATVTMAHFESAIDRVIGGLEKKNRVISKLERRTVAYHESGHAVVGWFLEHA
EPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGKISTGAQ
NDLEKVTKMTYAQVAVYGFSDKVGLLSFPPRDDGYDFSKPYSNKTGAIIDEEVRDWVAKA
YERTVELVEEHKVKVAEIAELLLEKEVLHQDDLLKILGERPFKSAEVTNYDRFKSGFEET
EKDSAATPTVEPVVDDGAPPPFEPQVVPT

Other information
Ka divergence:0.169518KaKs divergence:-0.195607
GC content 1 (%):46GC content 2 (%):44GC content divergence:-0.022
Length 1 (bp):2442Length 2 (bp):2430Length divergence:-0.002
MFE 1 (kcal):-778.52MFE 2 (kcal):-755.95MFE divergence-0.015