Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G07520-AT1G07530
Species:Arabidopsis
Duplication type:TD
Function (paralog1):GRAS family transcription factor
Function (paralog2):SCARECROW-like 14

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.2595215829037
Log2 mRNA fold difference:1.9940292462846
Log2 TE fold difference:0.3109155727753
Sequences
Protein sequence

MESNYSGVVNGYDVSFLPTSIPDLGFGVPSSSDFDLRMDQYYHQPSIWVPDQDHHFSPPA
DEIDSENTLLKYVNQLLMEESLAEKQSIFYDSLALRQTEEMLQQVISDSQTQSSIPNNSI
TTSSSSNSGDYSNSSNSSVRIENEVLFDNKHLGDSGVVSFPGSNMLRGGEQFGQPANEIL
VRSMFSDAESVLQFKRGLEEASKFLPNTDQWIFNLEPEMERVVPVKVEEGWSAISKTRKN
HHEREEEEDDLEEARRRSKQFAVNEEDGKLTEMFDKVLLLDGECDPQIIEDGENGSSKAL
VKKGRAKKKSRAVDFRTLLTLCAQSVSAGDKITADDLLRQIRKQCSPVGDASQRLAHFFA
NALEARLEGSTGTMIQSYYDSISSKKRTAAQILKSYSVFLSASPFMTLIYFFSNKMILDA
AKDASVLHIVDFGILYGFQWPMFIQHLSKSNPGLRKLRITGIEIPQHGLRPTERIQDTGR
RLTEYCKRFGVPFEYNAIASKNWETIKMEEFKIRPNEVLAVNAVLRFKNLRDVIPGEEDC
PRDGFLKLIRDMNPNVFLSSTVNGSFNAPFFTTRFKEALFHYSALFDLFGATLSKENPER
IHFEGEFYGREVMNVIACEGVDRVERPETYKQWQVRMIRAGFKQKPVEAELVQLFREKMK
KWGYHKDFVLDEDSNWFLQGWKGRILFSSSCWVPS

MGSYPDGFPGSMDELDFNKDFDLPPSSNQTLGLANGFYLDDLDFSSLDPPEAYPSQNNNN
NNINNKAVAGDLLSSSSDDADFSDSVLKYISQVLMEEDMEEKPCMFHDALALQAAEKSLY
EALGEKYPSSSSASSVDHPERLASDSPDGSCSGGAFSDYASTTTTTSSDSHWSVDGLENR
PSWLHTPMPSNFVFQSTSRSNSVTGGGGGGNSAVYGSGFGDDLVSNMFKDDELAMQFKKG
VEEASKFLPKSSQLFIDVDSYIPMNSGSKENGSEVFVKTEKKDETEHHHHHSYAPPPNRL
TGKKSHWRDEDEDFVEERSNKQSAVYVEESELSEMFDKILVCGPGKPVCILNQNFPTESA
KVVTAQSNGAKIRGKKSTSTSHSNDSKKETADLRTLLVLCAQAVSVDDRRTANEMLRQIR
EHSSPLGNGSERLAHYFANSLEARLAGTGTQIYTALSSKKTSAADMLKAYQTYMSVCPFK
KAAIIFANHSMMRFTANANTIHIIDFGISYGFQWPALIHRLSLSRPGGSPKLRITGIELP
QRGFRPAEGVQETGHRLARYCQRHNVPFEYNAIAQKWETIQVEDLKLRQGEYVVVNSLFR
FRNLLDETVLVNSPRDAVLKLIRKINPNVFIPAILSGNYNAPFFVTRFREALFHYSAVFD
MCDSKLAREDEMRLMYEKEFYGREIVNVVACEGTERVERPETYKQWQARLIRAGFRQLPL
EKELMQNLKLKIENGYDKNFDVDQNGNWLLQGWKGRIVYASSLWVPSSS

Other information
Ka divergence:-0.125652KaKs divergence:0.650777
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):2088Length 2 (bp):2310Length divergence:0.05
MFE 1 (kcal):-645.24MFE 2 (kcal):-711.92MFE divergence0.049