Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G07520-AT2G29060
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):GRAS family transcription factor
Function (paralog2):GRAS family transcription factor

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.52668061230502
Log2 mRNA fold difference:-0.88735863940985
Log2 TE fold difference:0.41493398644012
Sequences
Protein sequence

MESNYSGVVNGYDVSFLPTSIPDLGFGVPSSSDFDLRMDQYYHQPSIWVPDQDHHFSPPA
DEIDSENTLLKYVNQLLMEESLAEKQSIFYDSLALRQTEEMLQQVISDSQTQSSIPNNSI
TTSSSSNSGDYSNSSNSSVRIENEVLFDNKHLGDSGVVSFPGSNMLRGGEQFGQPANEIL
VRSMFSDAESVLQFKRGLEEASKFLPNTDQWIFNLEPEMERVVPVKVEEGWSAISKTRKN
HHEREEEEDDLEEARRRSKQFAVNEEDGKLTEMFDKVLLLDGECDPQIIEDGENGSSKAL
VKKGRAKKKSRAVDFRTLLTLCAQSVSAGDKITADDLLRQIRKQCSPVGDASQRLAHFFA
NALEARLEGSTGTMIQSYYDSISSKKRTAAQILKSYSVFLSASPFMTLIYFFSNKMILDA
AKDASVLHIVDFGILYGFQWPMFIQHLSKSNPGLRKLRITGIEIPQHGLRPTERIQDTGR
RLTEYCKRFGVPFEYNAIASKNWETIKMEEFKIRPNEVLAVNAVLRFKNLRDVIPGEEDC
PRDGFLKLIRDMNPNVFLSSTVNGSFNAPFFTTRFKEALFHYSALFDLFGATLSKENPER
IHFEGEFYGREVMNVIACEGVDRVERPETYKQWQVRMIRAGFKQKPVEAELVQLFREKMK
KWGYHKDFVLDEDSNWFLQGWKGRILFSSSCWVPS

MGSYSAGFPGSLDWFDFPGLGNGSYLNDQPLLDIGSVPPPLDPYPQQNLASADADFSDSV
LKYISQVLMEEDMEDKPCMFHDALSLQAAEKSLYEALGEKYPVDDSDQPLTTTTSLAQLV
SSPGGSSYASSTTTTSSDSQWSFDCLENNRPSSWLQTPIPSNFIFQSTSTRASSGNAVFG
SSFSGDLVSNMFNDTDLALQFKKGMEEASKFLPKSSQLVIDNSVPNRLTGKKSHWREEEH
LTEERSKKQSAIYVDETDELTDMFDNILIFGEAKEQPVCILNESFPKEPAKASTFSKSPK
GEKPEASGNSYTKETPDLRTMLVSCAQAVSINDRRTADELLSRIRQHSSSYGDGTERLAH
YFANSLEARLAGIGTQVYTALSSKKTSTSDMLKAYQTYISVCPFKKIAIIFANHSIMRLA
SSANAKTIHIIDFGISDGFQWPSLIHRLAWRRGSSCKLRITGIELPQRGFRPAEGVIETG
RRLAKYCQKFNIPFEYNAIAQKWESIKLEDLKLKEGEFVAVNSLFRFRNLLDETVAVHSP
RDTVLKLIRKIKPDVFIPGILSGSYNAPFFVTRFREVLFHYSSLFDMCDTNLTREDPMRV
MFEKEFYGREIMNVVACEGTERVERPESYKQWQARAMRAGFRQIPLEKELVQKLKLMVES
GYKPKEFDVDQDCHWLLQGWKGRIVYGSSIWVPL

www.000webhost.com

Other information
Ka divergence:-0.0656892KaKs divergence:0.676692
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):2088Length 2 (bp):2085Length divergence:-0.001
MFE 1 (kcal):-645.24MFE 2 (kcal):-635.3MFE divergence-0.008