Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G07560-AT2G28960
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Leucine-rich repeat protein kinase family protein
Function (paralog2):Leucine-rich repeat protein kinase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.14763474683475
Log2 mRNA fold difference:0.31005740747435
Log2 TE fold difference:-0.16335841790117
Sequences
Protein sequence

MKNLRGLLLAFLVLSLGISDFLRAQDQQGFISLDCGLQADESPYTEPLTKLTFTSDADFI
KSGKSGKIQNVPGMEYIKPYTVLRYFPDGVRNCYTLIVIQGTNYLIVAMFTYGNYDNLNT
HPKFDLYLGPNIWTTVDLQRNVNGTRAEIIHIPRSTSLQICLVKTGTTTPLISALELRPL
RNNTYIPQSGSLKTLFRVHLTDSKETVRYPEDVHDRLWSPFFMPEWRLLRTSLTVNTSDD
NGYDIPEDVVVTAATPANVSSPLTISWNLETPDDLVYAYLHVAEIQSLRENDTREFNISA
GQDVNYGPVSPDEFLVGTLFNTSPVKCEGGTCHLQLIKTPKSTLPPLLNAIEAFITVEFP
QSETNANDVLAIKSIETSYGLSRISWQGDPCVPQQLLWDGLTCEYTNMSTPPRIHSLDLS
SSELTGIIVPEIQNLTELKKLDFSNNNLTGGVPEFLAKMKSLLVINLSGNNLSGSVPQAL
LNKVKNGLKLNIQGNPNLCFSSSCNKKKNSIMLPVVASLASLAAIIAMIALLFVCIKRRS
SSRKGPSPSQQSIETIKKRYTYAEVLAMTKKFERVLGKGGFGMVYHGYINGTEEVAVKLL
SPSSAQGYKEFKTEVELLLRVYHTNLVSLVGYCDEKDHLALIYQYMVNGDLKKHFSGSSI
ISWVDRLNIAVDAASGLEYLHIGCKPLIVHRDVKSSNILLDDQLQAKLADFGLSRSFPIG
DESHVSTLVAGTFGYLDHEYYQTNRLSEKSDVYSFGVVLLEIITNKPVIDHNRDMPHIAE
WVKLMLTRGDISNIMDPKLQGVYDSGSAWKALELAMTCVNPSSLKRPNMSHVVHELKECL
VSENNRTRDIDTSRSMDINLSFGTDVNPKAR

MEGRRQRLLVFIFGALAITHLVQAQPPDQRGFISLDCGLPVNESPYTDPRTGLTFSSDAD
FILSGLRGEAGDDNTYIYRQYKDLRYFPDGIRNCYNLKVEQGINYLIRAGFGYGNYDGLN
VYPKFDLHVGPNMWIAVDLEFGKDREIIYMTTSNLLQICLVKTGSTIPMISTLELRPLRN
DSYLTQFGPLDLIYRRAYSSNSTGFIRYPDDIFDRKWDRYNEFETDVNTTLNVRSSSPFQ
VPEAVSRMGITPENASLPLRFYVSLDDDSDKVNVYFHFAEIQALRGNETREFDIELEEDI
IQSAYSPTMLQSDTKYNLSPHKCSSGLCYLKLVRTPRSTLPPLISAIEAFKVVDFPYAET
NPNDVAAMKDIEAFYGLKMISWQGDPCVPELLKWEDLKCSYTNKSTPPRIISLDLSSRGL
KGVIAPAFQNLTELRKLDLSNNSFTGGVPEFLASMKSLSIINLNWNDLTGPLPKLLLDRE
KNGLKLTIQGNPKLCNDASCKNNNNQTYIVPVVASVASVLIIIAVLILILVFKKRRPTQV
DSLPTVQHGLPNRPSIFTQTKRFTYSEVEALTDNFERVLGEGGFGVVYHGILNGTQPIAV
KLLSQSSVQGYKEFKAEVELLLRVHHVNLVSLVGYCDEESNLALLYEYAPNGDLKQHLSG
ERGGSPLKWSSRLKIVVETAQGLEYLHTGCKPPMVHRDVKTTNILLDEHFQAKLADFGLS
RSFPVGGETHVSTAVAGTPGYLDPEYYRTNRLNEKSDVYSFGIVLLEIITSRPVIQQTRE
KPHIAAWVGYMLTKGDIENVVDPRLNRDYEPTSVWKALEIAMSCVNPSSEKRPTMSQVTN
ELKQCLTLENSKRGVREDMGSRSSVEMSTSFTTEINPKAR

www.000webhost.com

Other information
Ka divergence:0.0808473KaKs divergence:-0.111111
GC content 1 (%):40GC content 2 (%):40GC content divergence:0
Length 1 (bp):2616Length 2 (bp):2643Length divergence:0.005
MFE 1 (kcal):-726.36MFE 2 (kcal):-724.37MFE divergence-0.001