Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G07570-AT2G28930
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):protein kinase 1B

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.21117215058805
Log2 mRNA fold difference:-0.094175626492397
Log2 TE fold difference:0.085766059044859
Sequences
Protein sequence

MLPPNYKAFLTHSLLSISWLRTKKIKKKGASTKYDAKDIGSLGSKASSVSVRPSPRTEGE
ILQSPNLKSFSFAELKSATRNFRPDSVLGEGGFGCVFKGWIDEKSLTASRPGTGLVIAVK
KLNQDGWQGHQEWLAEVNYLGQFSHRHLVKLIGYCLEDEHRLLVYEFMPRGSLENHLFRR
GLYFQPLSWKLRLKVALGAAKGLAFLHSSETRVIYRDFKTSNILLDSEYNAKLSDFGLAK
DGPIGDKSHVSTRVMGTHGYAAPEYLATGHLTTKSDVYSFGVVLLELLSGRRAVDKNRPS
GERNLVEWAKPYLVNKRKIFRVIDNRLQDQYSMEEACKVATLSLRCLTTEIKLRPNMSEV
VSHLEHIQSLNAAIGGNMDKTDRRMRRRSDSVVSKKVNAGFARQTAVGSTVVAYPRPSAS
PLYV

MKMGFVEKVKSNVFLYANYVFGCCIGASPKYMSSEANDSLGSKSSSVSIRTNPRTEGEIL
QSPNLKSFTFAELKAATRNFRPDSVLGEGGFGSVFKGWIDEQTLTASKPGTGVVIAVKKL
NQDGWQGHQEWLAEVNYLGQFSHPNLVKLIGYCLEDEHRLLVYEFMPRGSLENHLFRRGS
YFQPLSWTLRLKVALGAAKGLAFLHNAETSVIYRDFKTSNILLDSEYNAKLSDFGLAKDG
PTGDKSHVSTRIMGTYGYAAPEYLATGHLTTKSDVYSYGVVLLEVLSGRRAVDKNRPPGE
QKLVEWARPLLANKRKLFRVIDNRLQDQYSMEEACKVATLALRCLTFEIKLRPNMNEVVS
HLEHIQTLNEAGGRNIDMVQRRMRRRSDSVAINQKPNAGFARQTAVGVIATAYPRPSDSP
LFV

Other information
Ka divergence:-0.095751KaKs divergence:-0.491466
GC content 1 (%):45GC content 2 (%):42GC content divergence:-0.034
Length 1 (bp):1275Length 2 (bp):1272Length divergence:-0.001
MFE 1 (kcal):-413.02MFE 2 (kcal):-378.46MFE divergence-0.044