Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G07630-AT2G28890
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):pol-like 5
Function (paralog2):poltergeist like 4

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.49982794417435
Log2 mRNA fold difference:0.25338644310427
Log2 TE fold difference:0.21255156383093
Sequences
Protein sequence

MGNGVTKLSICFTGGGGERLRPKDISVLLPDPLDEGLGHSFCYVRPDPTLISSSKVHSEE
DTTTTTFRTISGASVSANTATPLSTSLYDPYGHIDRAAAFESTTSFSSIPLQPIPKSSGP
IVLGSGPIERGFLSGPIERGFMSGPLDRVGLFSGPLDKPNSDHHHQFQRSFSHGLALRVG
SRKRSLVRILRRAISKTMSRGQNSIVAPIKSVKDSDNWGIRSEKSRNLHNENLTVNSLNF
SSEVSLDDDVSLENQNLQWAQGKAGEDRVHVVVSEEHGWLFVGIYDGFNGPDAPDYLLSH
LYPVVHRELKGLLWDDSNVESKSQDLERSNGDESCSNQEKDETCERWWRCEWDRESQDLD
RRLKEQISRRSGSDRLTNHSEVLEALSQALRKTEEAYLDTADKMLDENPELALMGSCVLV
MLMKGEDIYVMNVGDSRAVLGQKSEPDYWLAKIRQDLERINEETMMNDLEGCEGDQSSLV
PNLSAFQLTVDHSTNIEEEVERIRNEHPDDVTAVTNERVKGSLKVTRAFGAGFLKQPKWN
NALLEMFQIDYVGKSPYINCLPSLYHHRLGSKDRFLILSSDGLYQYFTNEEAVSEVELFI
TLQPEGDPAQHLVQELLFRAAKKAGMDFHELLEIPQGERRRYHDDVSIVVISLEGRMWKS
CV

MGNGIGKLSKCLTGGAGRNKKPELSILEPDPLDEGLGHSFCYVRPDPTRVSSSKVHSEEE
TTTFRTISGASVSANTATPLSTSLYDPYGHIDRAAAFESTTSFSSIPLQPIPRSSGPIVP
GSGPLERGFLSGPIERGFMSGPLDGSSGPIDGKTGSDQFQRSFSHGLANLRVGSRKGSLV
RVLRRAISKTITRGQNSIVAPIKPVKEPDWVFGSDKTRIHQIENNLTVNSLNFSSEGSLL
DDDVSLESQNLQWAQGKAGEDRVHVVVSEEHGWLFVGIYDGFNGPDAPDYLLSHLYPAVH
RELKGLLWDDPKTDAKSSDEADVENRDSSSEKKSKNWEESQRRWRCEWDRDLDRLLKDRS
NGLDLDPDPNSSDVLKALSQALRKTEEAYLENADMMLDENPELALMGSCVLVMLMKGEDV
YLMNVGDSRAVLGQKAESDYWIGKIKQDLERINEETMNDFDGCGDGEGASLVPTLSAFQL
TVDHSTNVEEEVNRIRKEHPDDASAVSNERVKGSLKVTRAFGAGFLKQPKWNNALLEMFQ
IDYKGTSPYINCLPSLYHHRLGSKDQFLILSSDGLYQYFTNEEAVSEVELFITLQPEGDP
AQHLVQELLFRAAKKAGMDFHELLEIPQGERRRYHDDVSIVVISLEGRMWKSCV

Other information
Ka divergence:0.0234855KaKs divergence:-0.0634196
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1989Length 2 (bp):1965Length divergence:-0.006
MFE 1 (kcal):-614.78MFE 2 (kcal):-613.23MFE divergence-0.001