Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G07640-AT2G28810
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Dof-type zinc finger DNA-binding family protein
Function (paralog2):Dof-type zinc finger DNA-binding family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.5148155244828
Log2 mRNA fold difference:-0.042956532808684
Log2 TE fold difference:-1.3368083937802
Sequences
Protein sequence

MAFPSNWSQPTNSNHQHHLQHQLNENGSIISGHGLVLSHQLPPLQANPNPNHHHVATSAG
LPSRMGGSMAERARQANIPPLAGPLKCPRCDSSNTKFCYYNNYNLTQPRHFCKGCRRYWT
QGGALRNVPVGGGCRRNNKKGKNGNLKSSSSSSKQSSSVNAQSPSSGQLRTNHQFPFSPT
LYNLTQLGGIGLNLAATNGNNQAHQIGSSLMMSDLGFLHGRNTSTPMTGNIHENNNNNNN
ENNLMASVGSLSPFALFDPTTGLYAFQNDGNIGNNVGISGSSTSMVDSRVYQTPPVKMEE
QPNLANLSRPVSGLTSPGNQTNQYFWPGSDFSGPSNDLL

MVFSSVSSFLDPPINWPQSANPNNHPHHHQLQENGSLVSGHHQVLSHHFPQNPNPNHHHV
ETAAATTVDPSSLNGQAAERARLAKNSQPPEGALKCPRCDSANTKFCYFNNYNLTQPRHF
CKACRRYWTRGGALRNVPVGGGCRRNKKGKSGNSKSSSSSQNKQSTSMVNATSPTNTSNV
QLQTNSQFPFLPTLQNLTQLGGIGLNLAAINGNNGGNGNTSSSFLNDLGFFHGGNTSGPV
MGNNNENNLMTSLGSSSHFALFDRTMGLYNFPNEVNMGLSSIGATRVSQTAQVKMEDNHL
GNISRPVSGLTSPGNQSNQYWTGQGLPGSSSNDHHHQHLM

www.000webhost.com

Other information
Ka divergence:-0.0355261KaKs divergence:0.304529
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):1020Length 2 (bp):1023Length divergence:0.001
MFE 1 (kcal):-291.15MFE 2 (kcal):-295.54MFE divergence0.007