Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G07660-AT2G28740
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Histone superfamily protein
Function (paralog2):histone H4

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.098899678631812
Log2 mRNA fold difference:1.3109800213404
Log2 TE fold difference:-1.2199063463735
Sequences
Protein sequence

MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
IFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG

MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
IFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):51GC content 2 (%):43GC content divergence:-0.085
Length 1 (bp):312Length 2 (bp):312Length divergence:0
MFE 1 (kcal):-95.14MFE 2 (kcal):-72.23MFE divergence-0.137