Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G07720-AT2G28630
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):3-ketoacyl-CoA synthase 3
Function (paralog2):3-ketoacyl-CoA synthase 12

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.79741622732281
Log2 mRNA fold difference:0.89284065388883
Log2 TE fold difference:0.083596686452633
Sequences
Protein sequence

MDLLVMLLSLLVSYLIFKIWKRIDSKRDQNCYILDYQCHKPSDDRMVNTQFSGDIILRNK
HLRLNEYKFLLKAIVSSGIGEQTYAPRLFFEGREQRPTLQDGLSEMEEFYIDTIEKVLKR
NKISPSEIDILVVNVSMLNSTPSLSARIINHYKMREDIKVFNLTAMGCSASVISIDIVKN
IFKTYKNKLALVVTSESLSPNWYSGNNRSMILANCLFRSGGCAVLLTNKRSLSRRAMFKL
RCLVRTHHGARDDSFNACVQKEDELGHIGVHLDKTLPKAATRAFIDNLKVITPKILPVTE
LLRFMLCLLLKKLRSSPSKGSTNVTQAAPKAGVKAGINFKTGIDHFCIHTGGKAVIDAIG
YSLDLNEYDLEPARMTLHRFGNTSASSLWYVLGYMEAKKRLKRGDRVFMISFGAGFKCNS
CVWEVVRDLNVGEAVGNVWNHCINQYPPKSILNPFFEKYGWIHEEEDPDTFKMPEGFM

MDLLFLFFSLLLSYLFFKIWKLIDSKQDKDCYILDYQCHKPTDDRMVSTQFSGEIIYRNQ
NLGLTEYKFLLKAIVSSGIGEQTYAPRLVFEGREERPSLQDGISEMEEFYVDSIGKLLER
NQISPKDIDILVVNVSMLSSTPSLASRIINHYKMRDDVKVFNLTGMGCSASLISVDIVKN
IFKSYANKLALVATSESLSPNWYSGNNRSMILANCLFRSGGCAILLTNKRSLRKKAMFKL
KCMVRTHHGAREESYNCCIQAEDEQGRVGFYLGKNLPKAATRAFVENLKVITPKILPVTE
LIRFMLKLLIKKIKIRQNPSKGSTNLPPGTPLKAGINFKTGIEHFCIHTGGKAVIDGIGH
SLDLNEYDIEPARMTLHRFGNTSASSLWYVLAYMEAKKRLKRGDRVFMISFGAGFKCNSC
VWEVVRDLTGGESKGNVWNHCIDDYPPKSILNPYLEKFGWIQDEDPDTFKVPDAFM

Other information
Ka divergence:-0.312769KaKs divergence:-0.752405
GC content 1 (%):45GC content 2 (%):42GC content divergence:-0.034
Length 1 (bp):1437Length 2 (bp):1431Length divergence:-0.002
MFE 1 (kcal):-432.7MFE 2 (kcal):-425.33MFE divergence-0.009