Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G07870-AT2G28590
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.1566827832169
Log2 mRNA fold difference:0.3884234766641
Log2 TE fold difference:-1.5699628013615
Sequences
Protein sequence

MGCFGCSKKSSKRSETNKDTVINRKIVGGTTSVAKSDKRDDQTQPSSDSTKVSPYRDVNN
EGGVGKEDQLSLDVKGLNLNDQVTGKKAQTFTFQELAEATGNFRSDCFLGEGGFGKVFKG
TIEKLDQVVAIKQLDRNGVQGIREFVVEVLTLSLADHPNLVKLIGFCAEGDQRLLVYEYM
PQGSLEDHLHVLPSGKKPLDWNTRMKIAAGAARGLEYLHDRMTPPVIYRDLKCSNILLGE
DYQPKLSDFGLAKVGPSGDKTHVSTRVMGTYGYCAPDYAMTGQLTFKSDIYSFGVVLLEL
ITGRKAIDNTKTRKDQNLVGWARPLFKDRRNFPKMVDPLLQGQYPVRGLYQALAISAMCV
QEQPTMRPVVSDVVLALNFLASSKYDPNSPSSSSGKNPSFHRDRDDEEKRPHLVKETECE
GRTGNTRRGIFPVSEYWIHAIPVIVFLCFFTLWIFSHSVSVMNDGEIMSIHRLEKSMAVR
NESHVSLAILASSAVSPASSALVAVVSTNQNLTTFHNATQSQQNATQSVNKAKQPHAV

MGCFGRTPKSNKRSDTKTTKNNDFTPKKLTVNANRDKLTQPSSDCLKVSICGDVSKEIVT
KKDQLALDAKDTNVEDEVIVKKAQTFTFEELSVSTGNFKSDCFLGEGGFGKVYKGFIEKI
NQVVAIKQLDRNGAQGIREFVVEVLTLSLADHPNLVKLIGFCAEGVQRLLVYEYMPLGSL
DNHLHDLPSGKNPLAWNTRMKIAAGAARGLEYLHDTMKPPVIYRDLKCSNILIDEGYHAK
LSDFGLAKVGPRGSETHVSTRVMGTYGYCAPDYALTGQLTFKSDVYSFGVVLLELITGRK
AYDNTRTRNHQSLVEWANPLFKDRKNFKKMVDPLLEGDYPVRGLYQALAIAAMCVQEQPS
MRPVIADVVMALDHLASSKYDRSHRQKQDNVTETKVDEEKTLTTESNVCVEEKQEIKICS
DQAT

www.000webhost.com

Other information
Ka divergence:0.38028KaKs divergence:0.3084
GC content 1 (%):44GC content 2 (%):39GC content divergence:-0.06
Length 1 (bp):1617Length 2 (bp):1275Length divergence:-0.118
MFE 1 (kcal):-480.36MFE 2 (kcal):-338.4MFE divergence-0.173