Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G07920-AT1G07930
Species:Arabidopsis
Duplication type:TD
Function (paralog1):GTP binding Elongation factor Tu family protein
Function (paralog2):GTP binding Elongation factor Tu family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.1135233315109
Log2 mRNA fold difference:-0.062919553995965
Log2 TE fold difference:-0.057858670615592
Sequences
Protein sequence

MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK
VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD
VYKIGGIGTVPVGRVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNV
KNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
SEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQT
VAVGVIKSVDKKDPTGAKVTKAAVKKGAK

MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK
VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD
VYKIGGIGTVPVGRVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNV
KNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
SEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQT
VAVGVIKSVDKKDPTGAKVTKAAVKKGAK

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):50GC content 2 (%):49GC content divergence:-0.01
Length 1 (bp):1350Length 2 (bp):1350Length divergence:0
MFE 1 (kcal):-457.52MFE 2 (kcal):-459.4MFE divergence0.002