Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G07990-AT2G28360
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SIT4 phosphatase-associated family protein
Function (paralog2):SIT4 phosphatase-associated family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.070330592885696
Log2 mRNA fold difference:-0.20064677235803
Log2 TE fold difference:0.44301769634465
Sequences
Protein sequence

MFWKLTSLSASSPVEIILDKENFTLEELLDEEEIIQECKALNSRLINFLRDKAQVEQLLR
YIVEEPPQDADSKRAFKFPFISCEIFTCEIDVILKTLVEDEELMNLLFSFLEPNRPHSAL
LAGYFSKVVICLMIRKTAALMNYVKGHQNVFCQLVDLIGITSIMEVLVRLVGADDQVYPN
FLDVMQWLADSNLLEMIVDKLKPSSPPEVQANAAETLCAISRNAPSALATQLSSPGYVAK
IFGHALEDSHSKSGLVHSLSVCTSLLDPRRSAVSSSMFNSYRGQHMFESPVPVSPETIGA
MLPKLNDLLMLLTVASDSTVLPTTYGELRPPLGKHRLKIVEFIAVLLKTRSEAAQKELVS
SGTIKRTLDLFFEYPYNNALHHQVESIILSCLENKSDLMVNHILRDCDLIGKFLLSDRDS
NLLGDSQPTVAASGKKKPRVGYVGHITRISNKIGQLSNSNGQIKAYLQENSEWNEWQGSV
LQDRNTVENVNRWGCGRPTTLQDRTRDSDEEDRDYDVAALANNLSQAFRYKIYGNDDNEE
DHNALDRDDDDVYFDDESAEVVISSLRLGDDQGSLFTNSNWFTFQDDRFGSTPSDTAGSN
TIDVELNKTYNANTSSSDDDEVVVGEEDDDLTGNPKDNALNTTETNFQMESPLDFFDFNT
SQKAEEAFAEQPPEWVGWGEPSDMQASGTGLNPFIDDDDDDDSKHIMNLDIPMAEVKSES
MIPNGSERSLFEKDVEFVGVEPEGAEKAMEQAMKEGIVGEAGVMKKNKEMAEDSKPEESS
GGVKEFNDNNYWKVDQEVGVLE

MFWKLASLSASSPVESILDKDSFTLEELLDEEEIIQECKALNSRLINFLREKTQVEKLLR
YVVEEPEDDADSKRAFKFPFISCEIFTCEIDVILKTLVEDEKLMDLLFGFLEPNRPHSAL
LAGYFGKVVICLMIRKTSALMSYIKGHGNVFSQLVDLIGITSIMEVLVRLVGADDHVYPN
FPDVMRYLADSDLLEMIVDKLNPSSPPEVQANAAETLCAITRNAPSALATKLSSPGFVSR
IFGHAIEDSHSKSGLVHSLTVCISLLDPRRSGASSPFFNSYRGQNMFESPVPVTQETIGA
MLPKLGDMLVLLSVTSDSKVLPTTYGELRPPLGKHRLKIVEFIAVLLKSGNEAAGTELAI
SGTIKRILELFFEYPYNNALHHQVESIILSCLENKSEIMVNHILQDCNLISKILSSDKDS
ALSGDNLPTVVATGKKPPRVGYVGHITRLWNKLVQLSDSNALIKTSLQENSEWNEWQSSV
LKERNTVENVYRWACGRPTTLQDRTRDSDEEDRDYDVAALANNLNQAFNYRIYGNEDNEE
DQNALNALDRDDSDSYFDDESAEVVISSLRLGDDQGSLLTNSDWFTFQDDRFSNPTSDTM
IEDVNMNETTNANDSSSSDDELLVEEEEDDDLTEKSKNISPSNLSTSDSTSINISSENND
EPSDMQVTSSSLNPFIDVPMLDVKPEPVIPNSSPTSSESSSLGHKSPSSPAVRALFEEDV
EFVGVEPEGTEKAMDQALKEGIVGEAGPLKRNIVQKVPENENQAENSGVTEFNDANFWRV
DQEVTVLE

Other information
Ka divergence:0.204741KaKs divergence:0.291014
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):2409Length 2 (bp):2367Length divergence:-0.009
MFE 1 (kcal):-693.5MFE 2 (kcal):-672.47MFE divergence-0.015