Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G08000-AT1G08010
Species:Arabidopsis
Duplication type:TD
Function (paralog1):GATA transcription factor 10
Function (paralog2):GATA transcription factor 11

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.52880450570053
Log2 mRNA fold difference:1.1926234504614
Log2 TE fold difference:-0.44019414365696
Sequences
Protein sequence

MNWLPEAEAEEHLKGILSGDFFDGLTNHLDCPLEDIDSTNGEGDWVARFQDLEPPPLDMF
PALPSDLTSCPKGAARVRIPNNMIPALKQSCSSEALSGINSTPHQSSAPPDIKVSYLFQS
LTPVSVLENSYGSLSTQNSGSQRLAFPVKGMRSKRRRPTTVRLSYLFPFEPRKSTPGESV
TEGYYSSEQHAKKKRKIHLITHTESSTLESSKSDGIVRICTHCETITTPQWRQGPSGPKT
LCNACGVRFKSGRLVPEYRPASSPTFIPSVHSNSHRKIIEMRKKDDEFDTSMIRSDIQKV
KQGRKKMV

MNWLPEAEAEDDFKGLLSGDFFDDLINHLDVPLDDIDTTNGEGDWVDRFQDLEPPPMDMF
PTLPSDLTSCGSGMAKAPRVDIQRNIPALKQSYSSEALSSTLHQSSAPPEIKVSKLFQSL
SPVSVLENSYGSLSTHNNGSQRLAFPVKGMRSKRKRPTTLRLSYLFPSEPRKPEKSTPGK
PESECYFSSEQHAKKKRKIHLTTRTVSSTLEASNSDGIVRKCTHCETTKTPQWREGPSGP
KTLCNACGVRFRSGRLVPEYRPASSPTFIPAVHSNSHRKIIEMRRKDDEQFDSSMIRAVI
SRG

www.000webhost.com

Other information
Ka divergence:-0.314771KaKs divergence:-0.0178271
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):927Length 2 (bp):912Length divergence:-0.008
MFE 1 (kcal):-288.4MFE 2 (kcal):-276.2MFE divergence-0.022