Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G08040-AT2G28310
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF707)
Function (paralog2):Protein of unknown function (DUF707)

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:1.2519103684532
Log2 mRNA fold difference:0.38543888560406
Log2 TE fold difference:0.68141846599067
Sequences
Protein sequence

MGTMHRSGAPRRTNENAKLIITTIVGVVFGFFVGITLPLGSFRKISLPSGLMSSLDVAMS
DGKLFSGGRSPEDIGSRKSPKIYVPTNPHGAELLPPGIIVAETDFYLRRLWGEPSEDLKK
KPKYLVTFTVGFEQRNNINAAVKKFSEDFQILLFHYDGRTTEWDQFEWSKNAIHISAKKQ
TKWWYAKRFLHPDVVSAYEYIFIWDEDLGVEHFNADRYVELVKKHGLEISQPGLEPNNGL
TWEMTKRRGDRDVHKETKEKPGWCSDPHLPPCAAFVEIMAPVFSREAWRCVWHMIQNDLV
HGWGLDFALRRCVEPAHEKIGVVDSQWIIHQVIPSLGSQGESEEGKSPWQGVRERCRNEW
TMFQNRVAEADKAYMEQHKVKE

MGTMHRSGAPRRTNENAKVIITTILGIVFGTFIGITLPSLSFKINLPSRLISSLDVAISG
DKSPEDFGSRKFPEIYVPTNPRGAELLPPGIVVAKTDFYLRRLWGEPNEDLKKKPKYLVT
FTVGFEQRNHINGVVKKFSEDFQILLFHYDGRTTEWDQFEWSKSAIHISTRKQTKWWYAK
RFLHPDVVSAYEYIFIWDEDLGVEHFNADKYIELVKKHGLEISQPGLEPNNGLTWEMTKR
RGDREVHKDTKEKPGWCKDPHLPPCAAFVEIMAPVFSREAWRCVWHMIQNDLVHGWGLDF
ALRRCVEPAHEKIGVVDSQWIIHKVIPSLGSQGKSENGKAPWQGVRDRCKMEWTMFQNRL
ADADKEYLGKMVKD

www.000webhost.com

Other information
Ka divergence:0.0914182KaKs divergence:-0.111688
GC content 1 (%):42GC content 2 (%):41GC content divergence:-0.012
Length 1 (bp):1149Length 2 (bp):1125Length divergence:-0.011
MFE 1 (kcal):-328.9MFE 2 (kcal):-296.7MFE divergence-0.051