Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G08200-AT2G27860
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):UDP-D-apiose/UDP-D-xylose synthase 2
Function (paralog2):UDP-D-apiose/UDP-D-xylose synthase 1

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.3765897872234
Log2 mRNA fold difference:1.0271568193172
Log2 TE fold difference:-0.50154939683584
Sequences
Protein sequence

MANGADRLDLDGKPIKPMTICMIGAGGFIGSHLCEKLMTETPHKVLALDVYNDKIKHLLE
PDTVQWAGRIQFHRINIKHDSRLEGLIKMADLTINLAAICTPADYNTRPLDTIYSNFIDA
LPVVKYCSENNKRLIHFSTCEVYGKTIGSFLPKDHPLRQDPEFYVLKEDISPCIFGSIEK
QRWSYACAKQLIERLVYAEGAENGLEFTIVRPFNWIGPRMDFIPGIDGPSEGVPRVLACF
SNNLLRREPLKLVDGGESQRTFIYIKDAIEAVLLMIENPERANGHIFNVGNPNNEVTVRQ
LAEMMTEVYAKVSGETAIESPTIDVSSKEFYGEGYDDSDKRIPDMTIINRQLGWNPKTSL
WDLLESTLTYQHTTYAEAIKKATSKPVAS

MANGANRVDLDGKPIQPLTICMIGAGGFIGSHLCEKLLTETPHKVLALDVYNDKIKHLLE
PDTVEWSGRIQFHRINIKHDSRLEGLVKMADLIINLAAICTPADYNTRPLDTIYSNFIDA
LPVVKYCSENNKRLIHFSTCEVYGKTIGSFLPKDHPLRDDPAFYVLKEDISPCIFGSIEK
QRWSYACAKQLIERLVYAEGAENGLEFTIVRPFNWIGPRMDFIPGIDGPSEGVPRVLACF
SNNLLRREPLKLVDGGESQRTFVYINDAIEAVLLMIENPERANGHIFNVGNPNNEVTVRQ
LAEMMTEVYAKVSGEGAIESPTVDVSSKEFYGEGYDDSDKRIPDMTIINRQLGWNPKTSL
WDLLESTLTYQHRTYAEAVKKATSKPVAS

www.000webhost.com

Other information
Ka divergence:0.520213KaKs divergence:0.360269
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1170Length 2 (bp):1170Length divergence:0
MFE 1 (kcal):-359.41MFE 2 (kcal):-347.54MFE divergence-0.017