Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G08250-AT2G27820
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):arogenate dehydratase 6
Function (paralog2):prephenate dehydratase 1

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.440409581944
Log2 mRNA fold difference:1.5308837366234
Log2 TE fold difference:-0.12581372201355
Sequences
Protein sequence

MKALSSSSPILGASQPATATALIARSGRSEWQSSCAILTSKVISQEESESLPVPPVSGGV
DHLNGHNSAAARVPGMNLVPIEKSDSNPLVPQHRHNPLKPLSMTDLSPAPMHGSNLRVAY
QGVPGAYSEAAAGKAYPNCQAIPCDQFEVAFQAVELWIADRAVLPVENSLGGSIHRNYDL
LLRHRLHIVGEVQLPVHHCLLALPGVRKEFLTRVISHPQGLAQCEHTLTKLGLNVAREAV
DDTAGAAEFIASNNLRDTAAIASARAAEIYGLEILEDGIQDDVSNVTRFVMLAREPIIPR
TDRPFKTSIVFAHEKGTSVLFKVLSAFAFRDISLTKIESRPNHNRPIRVVDDANVGTAKH
FEYMFYVDFEASMAEARAQNALAEVQEFTSFLRVLGSYPMDMTPWSPTSSTSS

MRTLLPSHTPATVTTAARRRHVIHCAGKRSDSFSINSSSSDWQSSCAILSSKVNSQEQSE
SLSSNSNGSSSYHVSAVNGHNNGAGVSDLNLVPFNNNQSIQSKKPLSISDLSPAPMHGSN
LRVAYQGVPGAYSEAAAGKAYPNCQAIPCDQFEVAFQAVELWIADRAVLPVENSLGGSIH
RNYDLLLRHRLHIVGEVQLPVHHCLIALPGVRKEFLTRVISHPQGLAQCEHTLTKLGLNV
AREAVDDTAGAAEFIAANNIRDTAAIASARAAEIYGLEILEDGIQDDASNVTRFVMLARE
PIIPRTDRPFKTSIVFAHEKGTCVLFKVLSAFAFRNISLTKIESRPNHNVPIRLVDEANV
GTAKHFEYMFYIDFEASMAESRAQNALSEVQEFTSFLRVLGSYPMDMTSWSPSSSSSSSS
TFSL

Other information
Ka divergence:0.085484KaKs divergence:0.111929
GC content 1 (%):51GC content 2 (%):48GC content divergence:-0.03
Length 1 (bp):1242Length 2 (bp):1275Length divergence:0.013
MFE 1 (kcal):-427.69MFE 2 (kcal):-410.2MFE divergence-0.021