Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G08360-AT2G27530
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Ribosomal protein L1p/L10e family
Function (paralog2):Ribosomal protein L1p/L10e family

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.70930375498656
Log2 mRNA fold difference:0.91878956846874
Log2 TE fold difference:-0.19595728406412
Sequences
Protein sequence

MSKLQSEAVREAITTITGKSEAKKRNFVETIELQIGLKNYDPQKDKRFSGSVKLPHIPRP
KMKICMLGDAQHVEEAEKMGLENMDVESLKKLNKNKKLVKKLAKKYHAFLASESVIKQIP
RLLGPGLNKAGKFPTLVSHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQ
NVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPPQRIF

MSKLQSEAVREAITTIKGKSEEKKRNFVETVELQIGLKNYDPQKDKRFSGSVKLPHIPRP
KMKICMLGDAQHVEEAEKMGLSNMDVEALKKLNKNKKLVKKLAKSYHAFLASESVIKQIP
RLLGPGLNKAGKFPTLVSHQESLEAKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQLFQ
NVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPPQRIF

Other information
Ka divergence:0.68661KaKs divergence:-0.0336283
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):651Length 2 (bp):651Length divergence:0
MFE 1 (kcal):-195.3MFE 2 (kcal):-199.61MFE divergence0.011