Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G08410-AT2G27200
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):P-loop containing nucleoside triphosphate hydrolases superfamily protein
Function (paralog2):P-loop containing nucleoside triphosphate hydrolases superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.3955731073765
Log2 mRNA fold difference:-0.93972428113015
Log2 TE fold difference:-0.53859609365284
Sequences
Protein sequence

MGKSEKTSLGRSLVKHHNHMIQESKDKGKYYKNLQKKVLESVTEVSDIDAIIEQAEEAER
LYTINHSSSTPLSINLDTNSSSSVIAAEEWREQQKIEEALHASSLQVPRRPPWTPEMSVE
ELDANEKQAFLNWRRMLVSLEENEKLVLTPFEKNLDIWRQLWRVLERSDLIVMVVDARDP
LFYRCPDLEAYAQEIDEHKKIMLLVNKADLLPTDVREKWAEYFRLNNILFVFWSAIAATA
TLEGKVLKEQWRQPDNLQKTDDPDIMIYGRDELLSRLQFEAQEIVKVRNSRAASVSSQSW
TGEYQRDQAVVGFVGYPNVGKSSTINALVGQKRTGVTSTPGKTKHFQTLIISDELMLCDC
PGLVFPSFSSSRYEMIASGVLPIDRMTEHREAIQVVADKVPRRVIESVYNISLPKPKTYE
RQSRPPHAAELLKSYCASRGYVASSGLPDETKAARLILKDYIGGKLPHYAMPPGMPQADE
PDIEDTQELEDILEGSESDDSAVGDETENEQVPGIDDVLDDLSSFDLANGLKSSKKVTAK
KQTASHKQHKKPQRKKDRTWRVQNTEDGDGMPSVKVFQKPANTGPLTMR

MGKNEKTSLGRALVKHHNHMIQETKEKGKSYKDQHKKVLESVTEVSDIDAIIEQAEEAER
LFAIHHDSATPVPINMDTGSSSSGITAKEWKEQRMREEALHASSLQVPRRPHWTPKMNVE
KLDANEKQAFLTWRRKLASLEENEKLVLTPFEKNLDIWRQLWRVLERSDLIVMVVDARDP
LFYRCPDLEAYAQEIDEHKKTMLLVNKADLLPSYVREKWAEYFSRNNILFVFWSAKAATA
TLEGKPLKEQWRAPDTTQKTDNPAVKVYGRDDLLDRLKLEALEIVKMRKSRGVSATSTES
HCEQVVVGFVGYPNVGKSSTINALVGQKRTGVTSTPGKTKHFQTLIISEDLMLCDCPGLV
FPSFSSSRYEMVASGVLPIDRMTEHLEAIKVVAELVPRHAIEDVYNISLPKPKSYEPQSR
PPLASELLRTYCLSRGYVASSGLPDETRAARQILKDYIEGKLPHFAMPPEITRDDENETA
DDTLGAETREGSQTEKKGEEAPSLGLDQVLDDLSSFDLANGLVSSKTKQHKKSHRKQ

Other information
Ka divergence:-0.0412062KaKs divergence:-0.236963
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1770Length 2 (bp):1614Length divergence:-0.046
MFE 1 (kcal):-518.57MFE 2 (kcal):-464.61MFE divergence-0.055